Перевести страницу

Классическая волновая физика радиоэфира Фарадея-Максвелла

Рубиновая энергетика и эфироопорные двигатели

Пикотехнология белков

Биотехнология вечной молодости

Исследования мегалитов

Инопланетная инженерия




Доходность ПИКОСОФТА

Бумажный вариант книги "ПИКОТЕХНОЛОГИЯ БЕЛКОВ" стоит в 74,90 ЕВРО.

Купить книгу "ПИКОТЕХНОЛОГИЯ БЕЛКОВ" у издателя







ПИКОТЕХНОЛОГИЯ БЕЛКОВ создана на базе открытия А.Ю.Кушелевым в 1992 году композиционного генеического кода https://nano-world-articles.nethouse.ru/articles/314915 






http://nanoworld.org.ru/topic/1150/page/2/ 

В приложении-8 показаны примеры 100 структур белков, которые я определил за 1 рабочий день на одном персональном компьютере. Точность новой технологии (пикотехнологии) в 1000 раз выше точности нанотехнологии, скорость примерно в миллион раз быстрее. Кроме того, Рентгеном можно определять структуры только закристаллизованных белков, а это всего 3%. Остальные не присталлизуются. Для новой технологии такого ограничения нет. По старой технологии за каждую структуру белка в среднем кто-то платит 10 000 евро.




Потенциальные заказчики сообщили, что они смогут заказывать структуры в лаборатории Наномир, если будет официальное разрешение от NCBI. Такой комплект документов может стоить от 100 000 USD. Зато имея это разрешение можно зарабатывать миллион евро в день, имея один персональный компьютер. Приложение-8 с примерами белковых структур можно скачать бесплатно здесь: http://nanoworld.org.ru/topic/1150/











http://nanoworld.org.ru/topic/1453/page/96/

2016.10.14 21:46:18

Формы, механизмы, энергия наномира. Сообщение 80 957

В книге, которую рецензенты советуют использовать как первый учебник по пикотехнологии, в т.ч. белков, показана работоспособность классической физики в масштабах микромира. Нанотехнология против пикотехнологии - что сабля против пулемёта:http://subscribe.ru/archive/science.new … 50955.html

Экономический эффект от внедрения пикотехнологии составит 10^17 евро за десятилетие.




http://nanoworld.org.ru/topic/1150/page/2/ 

В расширенном электронном варианте можно заменить статические иллюстрации на динамические 3D-модели:

http://nanoworld88.narod.ru/data/271_files/0_b0f20_2c87f90a_orig.gif

2016.09.22 14:04:19

Формы, механизмы, энергия наномира. Сообщение 80 546

Вкусная реклама книги "Пикотехнология белков"

Приложение 8.

100 структур в формате PDB, PNG ... https://yadi.sk/d/nWEkBJRdhpP4D

На 2016-09-22 скачано 63 раза.

За каждую структуру по старой технологии заказчики платят в среднем по 10 000 евро.

100 структур, которые я определил за один рабочий день специально для публикации в книге "Пикотехнология белков", обошлись бы заказчикам в миллион евро smile

А список этих 100 белков был составлен Викторией Соколик:


https://img-fotki.yandex.ru/get/9803/158289418.20f/0_129778_35eeac24_orig.png


Вы уже заказали себе бумажный вариант книги "Пикотехнология белков"?

Или Вас устроит электронный вариант, который в 10 раз дешевле?



http://nanoworld.org.ru/topic/1150/ 

Вкусная реклама книги "Пикотехнология белков"

Рецензенты:

д.ф.-м.н. ШУЛЬГА Сергей Михайлович;
д.б.н. БОЖОК Галина Анатольевна

Соколик В.В., Кушелев А.Ю.
С 54 Геометрия живого наномира. Пикотехнология белков / В.В. Соколик, А.Ю. Кушелев. – Харьков: Издательство, 2015. – 255 с.
ISBN 978-3-659-92862-8


Монография посвящена 3D-структуре молекул и полимеров живых систем. Дан анализ современного понимания таких фундаментальных понятий, как физический объём атома, химическая связь, генетический код. На основе статистического анализа экспериментальных данных о структуре белка обосновано кодирование его вторичной структуры и структурного полипептидного шаблона в геноме. Предложена дополненная таблица генетического кода белков и пептидов, которая легла в основу геометрического алгоритма программ декодирования структурного шаблона белка Molecular Constructor и Picotech. Сформулирована гипотеза о перекодировании информации третьего нуклеотида кодона в соответствующий ротамер пептидной связи непосредственно 3D-структурой изоакцепторной тРНК. Математический анализ сопряженности значений углов φ и ψ (карта Рамачандрана) выявил периодичность их изменения, что позволило обосновать механизм посттрансляционного фолдинга белка.
Книга рассчитана на специалистов, занимающихся исследованиями в области молекулярной биологии, биоинформатики, биохимии, биофизики.
Табл.: 36 . Ил.:117 . Библиогр.: 227 назв.


Sokolik VV, Kushelev AY
Geometry live nanoworld. Pikotechnology proteins / VV Sokolik, AY Kushelev. - Kharkov: Publishing, 2015. – 255 p.
ISBN 978-3-659-92862-8
The monograph is devoted to the 3D-structure of molecules and polymers in living systems. The analysis of the modern understanding of the fundamental concepts of the physical volume of the atom, chemical bonding, and the genetic code is presented. Based on statistical analysis of the experimental data on the protein structure is justified coding secondary structure and structural polypeptide template of protein in the genome. Propose additions table of the genetic code of proteins and peptides, which formed the basis of the geometric algorithm software decoding structural template protein, are Molecular Constructor and Picotex. The hypothesis of recoding information to third nucleotide codon in the corresponding peptide bond rotamer directly 3D-structure isoacceptors tRNA is formulated. Mathematical analysis of contingency angles φ and ψ (Ramachandran map) revealed their frequency changes as possible to substantiate the mechanism of post-translational protein folding.
The book is intended for professionals involved in research in the field of molecular biology, bioinformatics, biochemistry and biophysics.
Table: 36. Ill: 117. Refs: 227 titles.


ПРЕДИСЛОВИЕ РЕЦЕНЗЕНТОВ


В 21-м столетии в задаче моделирования нанообъектов таких как атом углерода, органические молекулы, пары комплементарных нуклеотидов и многих других используется кольцегранная модель строения атома. В монографии В.В. Соколик и А.Ю. Кушелева «Геометрия живого наномира. Пикотехнология белков» при помощи кольцегранного подхода к строению атома наглядно (образ – модель) реализуются различные виды, свойства и особенности межатомных взаимодействий, валентные углы в молекулах, разновидности химических связей и их соотношение. Кольцегранная модель реалистично объясняет гибридизацию электронов при формировании химических связей в молекулах, что является краеугольным камнем всей биохимии белкового мира, поскольку атомы углерода в состоянии sp3-гибридизации своих электронов входят в состав скелета аминокислот и таким способом детерминируют углы между химическими связями в их молекулах, а в последующем и в структуре белка в целом.


В монографии В.В. Соколик и А.Ю. Кушелева «Геометрия живого наномира. Пикотехнология белков» сформулирована идея композиционного генетического кода, кодирования ротамерии пептидной связи и структурного шаблона белка. Показано, что в геноме третьим нуклеотидом кодона детерминирован один из трёх ротамерных вариантов пептидной связи, которым аминокислотный остаток (закодированный дуплетом первых двух нуклеотидом кодона) присоединяется к растущей полипептидной цепи. Ротамерный вариант пептидной связи реализуется в процессе синтеза белка в рибосоме и поэтому с неё сходит индивидуальный структурный шаблон белка в соответствие с информацией, содержащейся в его гене. Данный механизм трансляции генетической информации является эволюционно новым. Его формирование у эукариот было обусловлено необходимостью синтеза больших и сложных белков в виде структурного шаблона, максимально приближенного к функциональной конформации этих белков, чтобы их фолдинг имел наибольшие эффективность и однозначность. У прокариот и органелл эукариот третий нуклеотид кодонов в генах небольших полипептидов ещё не является информационным, поэтому на нём и наблюдается воблирование.


Выше изложенные положения легли в основу алгоритма авторских компьютерных программ, которые по нуклеотидной последовательности мРНК позволяют смоделировать схему вторичной структуры и 3D-структуру индивидуального структурного шаблон любого белка. Эту первичную информацию о белке можно использовать в дальнейшем моделировании фолдинга функциональной конформации белка с учетом физ-химии его микроокружения, посттрансляционных модификаций, взаимодействия с лигандами методами молекулярной динамики и доккинга наравне с информацией о наиболее стабильном конформере, которую извлекают из рентгенограмм кристаллов белков. Преимущество данного подхода состоит в возможности быстрого моделирования индивидуальной пространственной структуры отдельной молекулы любого белка с точностью до электрона (пикотехнология), опираясь лишь на информацию о нём в геноме. То есть in silico воспроизводится трансляция генетической информации в индивидуальный структурный шаблон белка. Не исключено, что большинство белков именно из конформации своего структурного шаблона максимально быстро, а главное однозначно, фолдируют в нативную конформацию с минимумом свободной энергии, формиру таким образом «устойчивое большинство» конформационно лабильного белкового пула.


Авторами монографии предложен современный, точный и удобный методологический подход в арсенале молекулярной биологии для моделирования пространственной структуры белков, исходя из той информации генома о них, которой располагает сама клетка.
Итак, перед читателем книга, вводящая в мир идей и результатов, ориентированных на применение в протеомике кольцегранной модели и молекулярный полиморфизм, основанный на структурном разнообразии биомакромолекул. В этой области причудливым и невероятным образом пересекаются достижения многих областей современной науки: физики и химии, биологии и медицины, математики и информатики.


Доктор физико-математических наук С.М. Шульга


В настоящее время моделирование пептидов и белков относится к современным и востребованным методическим подходам, позволяющим не только дополнять, но и порой с успехом заменять условно гуманные эксперименты на лабораторных животных, касающиеся взаимодействия различных биогенных соединений с клеточными структурами. К сожалению, данными подходами владеют немногие естествоиспытатели, успешно работающие в своих областях наук. И в этом случае монография В.В. Соколик и А.Ю. Кушелева «Геометрия живого наномира. Пикотехнология белков» позволяет если не овладеть, то, по крайней мере, понять суть применяемых авторами методов построения моделей белков и их кодирования в геноме. Тем более, что книга очень увлекательно и доступно написана. Достигается эта легкость понимания материала тем, что в монографии четко прослеживается научная логика рассуждений и методических подходов авторов. Читателя знакомят с развитием теории строения атома, как с традиционными уже исторически устоявшимися сведениями, так и с новыми интерпретациями кольцегранной структуры атома и аппроксимации геометрии кольцегранной электронной оболочки архимедовыми телами. Авторы пользуются новой «системой координат», их пикотехнология – это технология электронного уровня, разрешение и точность которой сопоставимы с толщиной закольцованного луча-электрона (пикометр – 10-12 м) в атомах белка. Именно этот подход лежит в основе разработанного авторами геометрического алгоритма определения атомного радиуса.

Одним из важнейших итогов материала монографии В.В. Соколик и А.Ю. Кушелева является реальная возможность с помощью законов геометрии макромира рассчитывать положения атомов в молекуле, не прибегая к квантово-механическим функциям. Такие перспективы обеспечиваются ещё и закономерностями формообразования молекул, которые определены структурой внешних кольцегранных оболочек их атомов, которая, как показано авторами, типична для элементов каждой группы таблицы Менделеева. Сопоставление в монографии экспериментальных данных с представленными моделями протеиногенных аминокислот, рассчитанными геометрическим способом для шаблона многогранных моделей аминокислот, аргументирует убедительность и логичность методологии авторов. Кроме моделей самих аминокислот авторы уточняют способ объединения их в полипептидах, возможность формирования трех видов ротамеров пептидной связи (R, 0 или L-ротамеров), которые интерпретируются авторами в качестве прототипов соответствующих конформеров вторичной структуры в белках.


Через призму теории формирования внешней электронной кольцегранной оболочки атома авторы рассматривают последовательно весь геометрический процесс построения пептидов – от пространственной структуры аминокислот до вторичной конформации и этапов фолдинга белковой молекулы. Логичным фрагментом исследований, изложенных в монографии, является объяснение способа и механизма кодирования и декодирования информации о структурном шаблоне белка в геноме.


Детально охарактеризованы декодированные в программах Molecular Constructor и Picotech В.В. Соколик и А.Ю. Кушелева структурные шаблоны белков в качестве субъектов последующего фолдинга. Представлен количественный сравнительный анализ декодированных структур с соответствующими экспериментальными моделями из базы данных PDB. Особое внимание уделено способам описания пространственной структуры белка и характеристике элементов вторичной структуры, а также современным методам моделирования in silico.


Следует отметить, что данная монография актуальна не только как научный труд. Собственный интерес авторов к своей работе заражает, более чем полный массивный объем информации, увлекательная и яркая форма ее изложения и оформления делает монографию применимой также и в качестве учебника для студентов естественнонаучных специальностей, особенно таких, как биохимия, биофизика и биотехнология.


Доктор биологических наук Г.А.Божок




Вкусная реклама книги "Пикотехнология белков"

Здравствуйте.
Меня интересует вопрос, зачем при репликации удаляются праймеры? Я понимаю что это кусок рнк, был создан для начала репликации, но ведь он полностью совпадает с родительской цепочкой ДНК, зачем удалять эти нуклеотиды и вставлять такие же?


Это связано с механизмом репликации. В процессе эволюции возник механизм, который работает через удаление с последующим восстановлением.


Аналогичный механизм используется для реализации композиционного генетического кода. Это механизм трансляции: http://nanoworld88.narod.ru/data/227.htm


http://nanoworld88.narod.ru/data/227_files/0_4829f_ebf358c0_XL.png


тРНК подплывает к рибосоме антикодоновым концом и ... срезает триплет иРНК, который находится на сайте трансляции. При этом тРНК продолжает вращаться:

http://img-fotki.yandex.ru/get/5706/nanoworld2003.28/0_4f335_3e755a19_S.gif


По инерции тРНК может повернуться больше, чем на 360 градусов, но третье азотистое основание срезанного триплета тРНК останавливается раньше, встретив комплементарное основание композиционного сайта рибосомальной РНК. Так кодируется угол поворота аминокислоты, которая вращается вместе с тРНК на ССА-конце:


http://img-fotki.yandex.ru/get/9223/483405.21a/0_82497_9f79885f_S.gif


После установки аминокислоты под закодированным углом в растущую структуру белка триплет иРНК возвращается на место, и восстановленная структура иРНК продвигается на один триплет к выходу из рибосомы.


При репликации работает аналогичный механизм, который удаляет праймер. Этот праймер в отрезанном виде выполняет некую функцию, после чего надо вернуть его или его копию на место.


В 2015-ом году опубликована статья, в которой показан результат сканирования поверхности атомов с помощью АСМ (атомного силового микроскопа). Этот эксперимент подтвердил модельные эксперименты, которые привели к созданию пикотехнологии, в т.ч. белков:http://subscribe.ru/archive/science.new … 14532.html


https://img-fotki.yandex.ru/get/15543/158289418.21b/0_12dd37_2a26bec2_orig.jpg


Понятно, что это научное направление будет развиваться и поможет проследить работу не только механизма трансляции, но и механизма репликации во всех подробностях.


Вам может очень пригодиться книга "Пикотехнология белков":


https://img-fotki.yandex.ru/get/6744/158289418.210/0_129786_b903f572_orig.png






ПЕРЕПИСКА С МЕНЕДЖЕРОМ
[21:01:05] Andrei: кстати ответ про отличие точности с нано не дан до конца
[21:01:21] Andrei: непонятно что измеряется в нано
[21:01:30] Andrei: молекулы?
[21:03:32] Andrei: есть ли конкретно две картинки одного и того же в нано и пико?
[21:03:40] Andrei: но чтобы рядом было
[21:03:42] Кушелев Александр Юрьевич: В нанометрах можно измерять и размеры атомов, молекул, и длины волн. А пикометр 10^-12 отличается от нанометра 10^-9 в 1000 раз
[21:04:44] Кушелев Александр Юрьевич: Здесь есть сравнение нанотехнологических моделей с пикотехнологическими: http://nanoworld88.narod.ru/data/212.htm
[21:05:21] Andrei: а есть две картинки рядом чтобы было понятно людям?
[21:09:22] Кушелев Александр Юрьевич:

http://nanoworld88.narod.ru/data/212_files/0_48888_9c8642fd_orig.gif

http://nanoworld88.narod.ru/data/212_files/0_48ad1_768200e6_L.png



[21:09:54] Кушелев Александр Юрьевич: Верхняя картинка - нано, нижняя - пико
[21:10:44] Andrei: то есть нижняя картинка должны быть точкой на верхней, так?
[21:10:52] Andrei: и где эта точка?
[21:11:10] Andrei: почему нужно гадать?
[21:13:40] Кушелев Александр Юрьевич: На нижней картинке пико-точность, там видно в 1000 раз больше деталей.
[21:14:05] Кушелев Александр Юрьевич: Каждое колечко на нижней картинке - электрон. На верхней Вы электронов вообще не видите
[21:14:18] Кушелев Александр Юрьевич: Как, впрочем и целых атомов.
[21:14:32] Andrei: а что видно на верхней? как это называется?
[21:14:32] Кушелев Александр Юрьевич: На верхней картинке Вы видите только символическое изображение альфа-спиралей
[21:14:46] Andrei: хорошо, сейчас понятно
[21:18:23] Andrei: кстат и там 2 нано картинки в чем отличие?
[21:19:34] Кушелев Александр Юрьевич: Вы отличие видите?
[21:20:07] Andrei: да, спирали отличаются
[21:20:55] Кушелев Александр Юрьевич: ОК
[21:20:56] Andrei: вверху цветные и более растянутые
[21:21:21] Andrei: какая картинка правильней?
[21:22:53] Andrei: эти картинки сделаны в разных программах или что?
[21:23:47] Andrei: надпись на английском относится к верхней картинке?
[21:23:56] Andrei: или к нижней?
[21:25:11] Andrei: просто не хочется путать людей если спросят
[21:26:40] Andrei: по логике могу лишь сделать гадание что верхняя картинка это программа сделала а внизу видимо снимок
[21:26:50] Andrei: так?
[21:28:19] Andrei: кстати про разницу между терминами нано и пико объяснено за путанно, можно проще объяснить
[21:29:00] Andrei: это и так ясно что разница в 3 порядка и без объяснений
[21:30:12] Кушелев Александр Юрьевич: Все картинки сделаны в программах.
[21:30:53] Andrei: было бы неплохо это подписать для достоверности
[21:31:41] Andrei: там написано снимок с микроскопа, это тоже программа?
[21:32:30] Кушелев Александр Юрьевич: Изображения из под микроскопов - результат компьютерной обработки неких данных
[21:33:00] Andrei: хорошо, внизу данные из микроскопа а вверху откуда?
[21:33:47] Andrei: или это те же данные но в разных программах?
[21:35:51] Кушелев Александр Юрьевич: Мои данные из программы Пикотех.
[21:36:11] Кушелев Александр Юрьевич: Нанотехнологические данные - результат компьютерной обработки данных РСА
[21:37:18] Andrei: то есть Пикотех и нанокартинки строит?
[21:38:15] Andrei: кстати на пикокартинке не видны спирали отчетливо
[21:38:34] Andrei: так, как на нанокартинке
[21:39:00] Andrei: как так?
[21:41:00] Кушелев Александр Юрьевич: Программа Пикотех выдаёт стандартный файл с координатами атомов, по которому стандартные браузеры построят всё по нанотехнологическому стандарту. Но дополнительно выдаёт и более детальную информацию, т.е. может показать все электроны. Нанотех электроны показать не может. Да и атомы показывает не там, где они есть...
[04.12.2016 21:41:38] Andrei: так, хорошо, это я запишу себе для людей
[04.12.2016 21:43:14] Andrei: уже проясняется
[04.12.2016 21:46:25] Andrei: а такой вопрос - если два белка столкнуть вместе рядом - в этом есть какой-то смысл?
[04.12.2016 21:46:43] Andrei: бывает ли такое в реальности?
[04.12.2016 21:47:15] Andrei: как белки взаимодействуют между собой и окружающим веществом?
[04.12.2016 21:48:41] Andrei: там спирали сталкиваются ли на уровне атомов происходит взаимодействие?
[04.12.2016 22:44:02] Кушелев Александр Юрьевич: На этот вопрос даже Гугл знает ответ
[8:15:39] Andrei: http://chem21.info/info/32732/
[8:15:46] Andrei: вот что нашел
[8:17:19] Andrei: кстати а может программа расчитать четвертичную структуру?
[8:17:28] Andrei: http://www.agromage.com/stat_id.php?id=720
[11:17:21] Кушелев Александр Юрьевич: Существующая версия программы Пикотех определяет только вторичную и третичную структуры белка, причём такими, какими их делает рибосома.
[11:19:10] Andrei: А на картинке написана четверичная структура
[11:20:37] Andrei: гистон 5
[11:20:48] Andrei: там где спирали
[11:20:51] Andrei: как так?
[11:21:02] Andrei: или это опечатка?
[11:22:14] Кушелев Александр Юрьевич: Четвертичную структуру я могу определять лишь вручную
[11:22:35] Andrei: а они как сделали?
[11:23:43] Andrei: в этом их программа сильней?
[11:27:02] Кушелев Александр Юрьевич: Четвертичную структуру хорошо показывает РСА. Более того, её можно иногда увидеть даже в микроскоп smile
[11:28:52] Кушелев Александр Юрьевич: Программа Пикотех моделирует работу рибосомы, а рибосома делает только третичную структуру. Как потом соберутся субъединицы белков  четвертичную структуру, определяет физико-химическое взаимодействие. И это не очень сложная задача, т.е. как собрать домик из блоков известной формы.
[11:29:57] Кушелев Александр Юрьевич: Наиболее востребована именно третичная структура, которая собирается программой Пикотех автоматически. Именно эти результаты Пикотех я и предлагаю делать на заказ. Всё остальное не так эффективно.




Инвестирование, лицензии, менеджемент, продвижение, представительство

Работа с менеджером по нескольким научным направлениям     1   2   3   4   5   6   7





Конкурс CASP December 2017

http://nanoworld.org.ru/topic/1150/page/3/   2016.10.12 22:26:13  

Формы, механизмы, энергия наномира. Сообщение 80 867

Victoriy пишет:

Приглашение на очередную 12-ю CASP конференцию (на этот раз в Италии) December 10-13th 2016, Gaeta (Italy)
Правда регистрационный взнос в 1000 евро и это без дороги -- кусается smile.

CASP: Early bird registration deadline for the CASP12 meeting is October 10th
A reminder that the deadline for early bird registration for the CASP12 meeting in Gaeta is now very close - next Monday October 10th.

The second planning meeting, in which the assessors present their preliminary findings to the organizers, was held a couple of weeks ago, and there is some pretty exciting stuff. In particular, looks like substantial improvement in average "new fold" model accuracy, probably due to the new co-evolution methods. The new "is the model as good as experiment for understanding function" category has a team of four assessors, led by Russ Altman, and should produce substantial insights. Very intriguing comparisons between SAXS data, experimental structures, and models. Again we have a collaboration with CAPRI for modeling assemblies, with a more substantial body of data than previously. And, of course, many interesting results in comparative modeling, refinement, and accuracy estimation.

Registration: http://www.cevs.ucdavis.edu/confreg/ind … webid=4026

Specifics of the travel arrangements:
http://predictioncenter.org/casp12/meet … ctions.cgi

Additional information:

12th CASP Meeting
December 10-13th 2016, Gaeta (Italy)

The meeting concludes the 12th international CASP (Critical Assessment of Techniques for Protein Structure Prediction) experiment. The goal of the meeting is to discuss the state of the art of methods for predicting protein structure, assembly, and function from sequence, reporting and discussing the results of a blind assessment.


Confirmed invited speakers:
Russ Altman - Stanford University - USA
Alexandre Bonvin - Utrecht University - NL
Guido Capitani - Paul Scherrer Institut - CH
Matteo Dal Peraro - Ecole Polytechnique Federale de Lausanne - CH
Edward H. Egelman - University of Virginia - USA
Francesco Gervasio - UCL - UK
Michael Levitt - Stanford University - USA

Location

The meeting will be held at Hotel Serapo (www. http://www.hotelserapo.com/en/), on the slopes of the Natural Park of Monte Orlando in a beautiful and panoramic corner overlooking Serapo Beach, very close to the city center and the old town of Gaeta.

The city itself, the so-called Ulysses Riviera, is embedded in a fascinating area, full of surprises, natural beauties, history, art and culture. It is conveniently located between Rome and Naples. It overlooks the Tyrrhenian Sea. Its history as a resort dates back to Imperial Rome. Nearby sites include the first-century BC mausoleum of general Lucius Munatius Plancus. Its old town is mostly medieval, showcased by narrow alleys, the massive 13th-century castle and the 12th-century Cathedral of Assunta e Sant"Erasmo.


Registration details:
Deadline for early bird registration: October 10th, 2016
Deadline for late registration: November 14th, 2016

Registration fees (***):
Separate room Shared room
Early bird registration US$ 975 / ~850 Euro US$ 870 / ~750 Euro
Late registration US$ 1,125 / ~1000 Euro US$ 1,020 / ~900 Euro
Accompanying person (*) US$ 340 / ~300 Euro
Extra day before or after the meeting (**): US$ 90 / ~80 Euro per person

(*) Includes accommodation and full board for the period of the conference and Gala Dinner.
(**) Includes accommodation and full board.
(***) Depending on the resources available, some students might be entitled to receive a partial refund of the registration fee. Eligible registered applicants will be contacted after the early registration deadline. The amount of reimbursement will depend upon available financial resources.


Кушелев: Я бы очень хотел, чтобы Виктория Соколик, богиня пикотехнологии (а теперь ещё и богиня вечной молодости!) сделала доклад на конференции CASP. Ведь после создания пикотехнологии нанотехнология безвозвратно устарела. Это значит, что все, кто сегодня вкладывают в устаревшую нанотехнологию, выбрасывают деньги на ветер, а могли бы вложить в современную пикотехнологию и поднять нашу цивилизацию на новую ступень развития.


https://img-fotki.yandex.ru/get/58675/158289418.356/0_1613ab_1d664fd2_XL.jpg


Структура белка 1VOL. Совмещение с ДНК в Пикософте и PDB

Вводная часть 1 , 2 

Начало работы. Пикотехнологические модели двух частей комплекса 1VOL

https://nano-world-articles.nethouse.ru/articles/326755 


Кушелев: В комплексе 1VOL не две одноцепочечные РНК, а двойная спираль из 16 ступеней:

http://www.rcsb.org/pdb/pv/pv.do?pdbid= … ionumber=1

https://img-fotki.yandex.ru/get/143188/158289418.3a4/0_16d2b6_acc24aaa_XL.jpg



https://img-fotki.yandex.ru/get/196534/158289418.3a4/0_16d2d1_5547f72d_XL.png
Так выглядят две субъединицы ДНК из комплекса 1VOL

Можно более или менее красиво изобразить пикотехнологическую модель ДНК изолированными атомами.

https://img-fotki.yandex.ru/get/198303/158289418.3a4/0_16d2d5_72f71711_XL.png
Так в программе Hyperchem изображаются атомы азотистого основания гуанина. В принципе сносно.

Осталось добавить координаты атомов рибозы и фосфатной группы. А дальше дублировать нуклеотид, поворачивать и смещать на вектор, который можно взять из скрипта-конструктора ДНК.


Формы, механизмы, энергия наномира. Сообщение 83 020

http://nanoworld88.narod.ru/data/237_files/0_4dfa5_6905ee99_L.png

Удалось вписать в PDB файл координаты атомов азотистого основания (гуанина) и рибозы.

https://img-fotki.yandex.ru/get/196548/158289418.3a4/0_16d2d6_5e30d730_XL.png
Программа Hyperchem показывает атомы углерода светло-голубыми кружочками, атомы азота - синими, а атомы кислорода - красными. Верхний атом кислорода находится ближе к нам, чем плоскость азотистого основания, а два других - дальше. Все остальные атомы лежат в плоскости азотистого основания.                                        

Осталось добавить атом фосфора и три атома кислорода, чтобы завершить модель нуклеотида.
После этого можно будет его дублировать, поворачивать и смещать на вектор, который можно позаимствовать из скрипта "Конструктор ДНК/РНК"

Координаты атомов для файла PDB были взяты по этой разметке:

https://img-fotki.yandex.ru/get/176331/158289418.3a4/0_16d2d7_674cdb88_XL.jpg
Оригинал: https://img-fotki.yandex.ru/get/176331/ … 8_orig.jpg


Формы, механизмы, энергия наномира. Сообщение 83 022

https://img-fotki.yandex.ru/get/42692/158289418.3a5/0_16d2d8_bcc25a22_XL.png 
Координаты для PDB-файла определены.

https://img-fotki.yandex.ru/get/114758/158289418.3a5/0_16d2d9_cd41f6c9_XL.png
Модель нуклеотида (гуанинмонофосфата) готова.                       
            

Теперь осталось построить 16 звеньев одноцепочечной РНК, дублируя, поворачивая и сдвигая на известный вектор модель одного нуклеотида.

Осталось найти программу, в которой удобно ввести PDB-файл с моделью нуклеотида, скопировать, сдвинуть и повернуть. Кстати, этот вектор нужно умножить на согласующий коэффициент, т.к. модель нуклеотида собрана в другом масштабе...

В скрипте "ДНК-конструктор" радиус кольца-электрона задавался равным 4.8, а в PDB радиус равен 0.7. Соответственно вектор и точка привязки должны быть умножены на коэффициент 0.7/4.8=0,1458333

В программе PyMol вроде можно было задать вращение и перемещение численно. А если не получится, то записать в виде скрипта для 3DS Max, построить модель ДНК и вывести в виде файла координат. После чего добавить координаты в PDB-файл.

Кстати, классная плоская модель нуклеотида получится. Всего 23 вершины тонкой фигуры. Надо посмотреть, как будет выглядеть. Очень компактное графическое представление...


https://img-fotki.yandex.ru/get/4208/158289418.3a5/0_16d2fb_b5dfb41_XL.pnghttps://img-fotki.yandex.ru/get/54522/158289418.3a5/0_16d2fc_ef7f19ee_XL.png

Плоская модель нуклеотида, где вершинами являются выступающие ядра атомов, смотрится очень необычно...

Анимация: https://cloud.mail.ru/public/JXhm/Qz6NrbsRq


Построить на базе этой модели нуклеотида структуру одноцепочечной РНК - не проблема. Завтра мы с этого и начнём...

Плоские модели нуклеотидов могут очень пригодиться для моделирования гигантских РНК типа рибосомальной. Это очень компактное представление, в котором все ядра атомов могут быть установлены идеально.


Модель одноцепочечной РНК, состоящей из 16 нуклеотидов: https://cloud.mail.ru/public/69Aq/DxC1qoVho


На этой модели заметно, что на один оборот спирали приходится не 10, а 6 оснований ДНК. При шаге спирали 34 ангстрема на каждую ступень приходится 34/6 =5.67 ангстрема. По общепринятой версии на каждую ступень приходится 34/10=3.4 ангстрема. Это связано с неправильной настройкой угла между нуклеотидами.

http://nanoworld88.narod.ru/data/236_files/0_4e1a8_e8302c5f_M.gif
Позднее в процессе настройки я получил параметры, которые соответствуют данным РСА, т.е. 10 нуклеотидов на виток ДНК.

Так что углы поворота придётся подправить...


Формы, механизмы, энергия наномира. Сообщение 83 027

https://img-fotki.yandex.ru/get/197700/158289418.3a5/0_16d39e_b0e61ab7_XL.png


анимация: https://cloud.mail.ru/public/2dCq/DYkHq7aJt


Теперь оформим эти координаты в виде PDB-файла.


Но лучше сделать PDB-файл сразу для двухцепочечной РНК. Ведь удалить одну цепочку легко.


Анимация: https://cloud.mail.ru/public/3HLS/tEqiBm5wW


https://img-fotki.yandex.ru/get/149179/158289418.3a5/0_16d433_eca89796_XL.png


https://img-fotki.yandex.ru/get/171750/158289418.3a5/0_16d435_17477518_XL.png

https://img-fotki.yandex.ru/get/171750/158289418.3a5/0_16d436_22715fdf_XL.png

Понятно, что для 16 ступеней двухцепочечной ДНК PDB файл желательно сформировать с помощью скрипта для 3DS Max.


Skype, 2016-12-17:

[20:19:39] Кушелев Александр Юрьевич: Привет, Валентин!
[20:19:54] Кушелев Александр Юрьевич: Может сохранить из скрипта PDB-файл?
[20:19:56] Кушелев Александр Юрьевич: http://nanoworld.org.ru/post/80451/#p80451
[20:20:26] Кушелев Александр Юрьевич: Есть образец для 1 из 32 кусков, сделанный вручную
[20:22:20] Кушелев Александр Юрьевич: Правда, по образцу можно сделать 16 кусков PDB-файла, а другие 16 кусков на пару атомов меньше, поэтому я сделаю для них второй образец.
[20:25:56] Кушелев Александр Юрьевич: Второй образец отличается тем, что там отсутствует 14-й и 16- атомы из первого образца.
[20:28:25] Кушелев Александр Юрьевич: PDB-файл, который ты выведешь из скрипта, можно послать американскому заказчику, чтобы он вставил модель РНК в белковый комплекс. Если вставится, то это - победа пикотехнологии.
[20:29:16] Кушелев Александр Юрьевич: А если мы сами присобачим модель РНК к моделям белков, то можно будет опубликовать научную статью и подать на нобелевскую smile


 ПИКОМЕХАНИКА тРНК

 МОДЕЛЬ ФРАГМЕНТА ЛИЗОЦИМА

 МОДЕЛЬ ГИСТОННОГО КОМПЛЕКСА

 КОМПОЗИЦИОННЫЙ КОД


Skype, 2016-12-18:

[15:26:25] Кушелев Александр Юрьевич: Образец PDB-файла для одной ступени РНК/ДНК: http://nanoworld.org.ru/post/80481/#p80481
[15:27:46] Кушелев Александр Юрьевич: Нужно по этому шаблону сделать файл для 16 ступеней по этим координатам: http://nanoworld.org.ru/post/80451/#p80451
[15:28:50] Кушелев Александр Юрьевич: Это можно было бы сделать вручую в программе типа "Волков командер", где можно стоблцами оперировать. Но у меня эта программа не установлена...
[15:42:05] Va12220(valqwa): Саша, привет!
попробую. сегодня до вечера
[15:43:05] Кушелев Александр Юрьевич: Благодарю!
[15:51:14] Кушелев Александр Юрьевич: Интересно сделать вывод файла именно из скрипта, чтобы в будущем выводить такие файлы для РНК/ДНК и комплексов "белок-РНК/ДНК"


Victoriy

А.Ю., ещё раз сделала модели нуклеотидов и модель двух комплементарных пар А=Т и G=С
https://img-fotki.yandex.ru/get/102077/417565639.0/0_11b84a_45a92796_orig.jpg


Кушелев: Класс! Благодарю!

Что касается комплекса 1VOL, то там двухцепочечная ДНК, а я делаю модели РНК, т.к. из них ДНК получаются исключением OH групп.



[0:19:33] Va12220(valqwa): все. спать? )

https://img-fotki.yandex.ru/get/174613/158289418.3a5/0_16d601_4c2be31a_XL.png

https://img-fotki.yandex.ru/get/196183/158289418.3a5/0_16d602_93747e0b_XL.png

https://img-fotki.yandex.ru/get/174613/158289418.3a5/0_16d603_ed6fe55c_XL.png

https://img-fotki.yandex.ru/get/194425/158289418.3a5/0_16d604_58b8c191_XL.png

[0:19:57] Кушелев Александр Юрьевич: Класс!

[0:20:29] Va12220(valqwa): долго ли умеючи, ну смотри. делай выводы и поправки. пиши мне их.
[0:20:32] Кушелев Александр Юрьевич: А как ты оцениваешь сложность задачи показать все возможные точки роста молекулы белка?
[0:20:55] Кушелев Александр Юрьевич: На первом шаге 3 точки, на втором 9 и т.д.
[0:21:09] Va12220(valqwa): если ты дашь определение "точек роста молекулы белка" - то как обычную задачу
[0:21:42] Кушелев Александр Юрьевич: Ну помнишь задачу, где треугольник перемещался по трём вариантам?
[0:21:55] Кушелев Александр Юрьевич: Центр треугольника нужно изобразить точкой
[0:22:04] Кушелев Александр Юрьевич: От неё три точки
[0:22:09] Va12220(valqwa): скорее не помню. записи остались. по ним вспомню. когда найду )
[0:22:13] Кушелев Александр Юрьевич: От каждой следующей опять три точки
[0:22:48] Кушелев Александр Юрьевич: Вот алгоритм: .............

[0:23:13] Кушелев Александр Юрьевич: Но здесь по композиционному коду строится конкретная модель белка
[0:23:29] Кушелев Александр Юрьевич: Каждый аминокислотный остаток изображается многогранником
[0:23:39] Кушелев Александр Юрьевич: Подробнее: http://nanoworld88.narod.ru/data/263.htm
[0:23:43] Кушелев Александр Юрьевич: А нам нужно точкой
[0:24:16] Кушелев Александр Юрьевич: И чтобы на каждом шаге было показано не одна точка, а три, т.е. показаны все варианты композиции
[0:24:31] Кушелев Александр Юрьевич: На каждом шаге должно быть "дробление на три"
[0:24:50] Кушелев Александр Юрьевич: Точки должны утраиваться на каждом шаге алгоритма
[0:25:22] Кушелев Александр Юрьевич: Мы должны увидеть все варианты роста белка сразу
[0:25:34] Кушелев Александр Юрьевич: На первом шаге 3 варианта в виде 3 точек
[0:25:45] Va12220(valqwa): да можно все сделать. вот только уже не сейчас. сейчас - спать )


Татьяна Рясина пишет:

А чем вообще сегодня с учётом современных возможностей можно как следует до атома увидеть молекулы белков? Чтобы таки сопоставить 3D визуализацию по методу Пикотеха и данные экспериментов? Что вообще может прийти на смену РСА?

Кушелев: Кольцевые грани атомов удалось увидеть с помощью АСМ в 2014-ом году: http://nanoworld88.narod.ru/data/493.htm

Однако прощупывать молекулы белков таким способом очень трудоёмко. Я предполагаю, что раньше смогут определить формы некоторых молекул, например, азотистых оснований. Когда увидят, что атомы в азотистых основаниях расположены в шахматном порядке, ситуация снова резко изменится. Ведь во всех базах типа PDB сегодня формы молекул неправильные даже на уровне топологии, не говоря о форме.

После подтверждения формы ступени ДНК с помощью АСМ пикотехнологию будут воспринимать серьёзно.


[18.12.2016 22:00:47] Andrei: пришел ответ от доктора
[18.12.2016 22:01:31] Andrei: у Соколик лучше результат
[18.12.2016 22:01:37] Andrei: ближе к РСА
[18.12.2016 22:03:33] Кушелев Александр Юрьевич: Она к этому и стремилась.
[18.12.2016 22:04:04] Кушелев Александр Юрьевич: А можно посмотреть на этот ответ целиком?
[18.12.2016 22:04:38] Andrei: I used the models of PDB files to align with the experimental structure in the PDB.
For Kushelev model and 1volA the RMSD was 18 Angstrom (please see figure attached)

https://img-fotki.yandex.ru/get/110545/158289418.3a5/0_16d5f2_261f4f43_XL.png
For Sokolik TFIIB_204 model and 1volA the RMSD was 16.5 Angstrom
Finally for the alignment of of TFIIB and TFIIB_204  the RMSD was 18 Angstrom.
I used the Pymol software to calculate the alignments.
I wonder whether there is explanation to those results or I miss something.
In addition the sequence of TFIIB 1volA is attached in FASTA file just to make sure the the structural models are based on this specific sequence.
[18.12.2016 22:08:42] Кушелев Александр Юрьевич: Нужна последовательность FASTA и рисунки, вложенные в письмо
[18.12.2016 22:08:42] Andrei: еще есть файлы
[18.12.2016 22:08:49] Кушелев Александр Юрьевич: Давайте их посмотрим
[18.12.2016 22:09:13] Кушелев Александр Юрьевич: 18 анстрем - неплохо для РСА smile
[18.12.2016 22:09:56] Andrei: так 2А пишут в базе
[18.12.2016 22:10:07] Andrei: технология улучшилась
[18.12.2016 22:10:14] Кушелев Александр Юрьевич: Там можно и 0.002А написать. Вы тоже поверите? smile
[18.12.2016 22:10:45] Andrei: это официальная база, если обманут то это уголовное дело
[18.12.2016 22:10:55] Andrei: никто с этим не будет связываться
[18.12.2016 22:11:06] Andrei: там и репутация автора
[18.12.2016 22:11:31] Andrei: это не совок что кто что хочет то и пишет так как ответственности нет
[18.12.2016 22:11:55] Andrei: послал
[18.12.2016 22:11:59] Кушелев Александр Юрьевич: Вы же видели, что в 2012-ом году "обман" уменьшился на 3% по сравнению с 2010-ым годом smile
[18.12.2016 22:13:11] Кушелев Александр Юрьевич: Давайте лучше файлы посмотрим.
[18.12.2016 22:13:17] Andrei: послал говорю
[18.12.2016 22:13:26] Кушелев Александр Юрьевич: По почте?
[18.12.2016 22:13:30] Andrei: да

>1VOL:A PDBID CHAIN SEQUENCE
AMMNAFKEITTMADRINLPRNKVDRTNNLFRQAYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEI
CAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRS
PISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL

https://img-fotki.yandex.ru/get/113457/158289418.3a5/0_16d609_3d4263d7_S.gifhttps://img-fotki.yandex.ru/get/196237/158289418.3a5/0_16d60a_3625c753_S.pnghttps://img-fotki.yandex.ru/get/25921/158289418.3a6/0_16d60b_9c743780_S.gifhttps://img-fotki.yandex.ru/get/52656/158289418.3a5/0_16d60c_15c020fe_S.pnghttps://img-fotki.yandex.ru/get/170627/158289418.3a5/0_16d60d_315640ab_S.pnghttps://img-fotki.yandex.ru/get/113457/158289418.3a5/0_16d60e_8e13985e_S.pnghttps://img-fotki.yandex.ru/get/128227/158289418.3a5/0_16d60f_48fec44f_S.pnghttps://img-fotki.yandex.ru/get/170627/158289418.3a6/0_16d611_c9eb8bdd_S.gifhttps://img-fotki.yandex.ru/get/131711/158289418.3a5/0_16d612_dd6f0fc6_S.pnghttps://img-fotki.yandex.ru/get/194541/158289418.3a6/0_16d613_a53c7691_S.gifhttps://img-fotki.yandex.ru/get/102548/158289418.3a5/0_16d614_7464e284_S.pnghttps://img-fotki.yandex.ru/get/52656/158289418.3a6/0_16d615_19b5db72_S.pnghttps://img-fotki.yandex.ru/get/102077/158289418.3a6/0_16d616_617e6a39_S.pnghttps://img-fotki.yandex.ru/get/49312/158289418.3a6/0_16d617_260b955d_S.png

[18.12.2016 22:14:15] Andrei: забыл тот ответ - так почему днк должно войти в белок?
[18.12.2016 22:20:35] Кушелев Александр Юрьевич: Комплекс 1VOL - это две белковые молекулы, которые читают ДНК, поэтому структура белковых молекул должна быть согласована со структурой ДНК.
[18.12.2016 22:21:08] Кушелев Александр Юрьевич: РСА показывает, что ДНК проходит внутри белковых молекул. Но деталей не показывает.
[18.12.2016 22:21:35] Кушелев Александр Юрьевич: Если мы сделаем правильные пикотехнологические модели белков и ДНК, то увидим, как они сопрягаются на уровне пикометров.
[18.12.2016 22:22:00] Кушелев Александр Юрьевич: А реальная точность моделей, построенных по данным РСА - десятки-сотни ангстрем.
[18.12.2016 22:22:04] Andrei: когда это будет готово?
[18.12.2016 22:22:55] Кушелев Александр Юрьевич: Если сегодня Валентин сможет вывести PDB-файл молекулы ДНК, то сегодня же можно и попробовать совместить модель ДНК с моделями белков
[18.12.2016 22:23:53] Andrei: щас тогда напишу ей интересно ли ей это направление
[18.12.2016 22:24:46] Andrei: или лучше подождать?
[18.12.2016 22:24:53] Andrei: а то вдруг не сойдется
[18.12.2016 22:24:56] Кушелев Александр Юрьевич: Вы можете написать, что нам интересно построить полную модель комплекса, т.е. proteins + DNA
[18.12.2016 22:25:24] Кушелев Александр Юрьевич: Лучше немного подождать. Нужно проанализировать то, что она написала.
[18.12.2016 22:25:28] Andrei: ага


Skype, 2016-12-19:

[2:47:17] Кушелев Александр Юрьевич: PDB-файл ДНК готов: http://nanoworld.org.ru/topic/1530/page/9/
[8:52:08] Andrei: нужно к нему описание
[8:52:35] Andrei: что сделано и что хотим показать этим
[9:13:14] Кушелев Александр Юрьевич: Нужно сделать модель всего комплекса. Вот тогда будет что показать на Нобелевскую smile


https://img-fotki.yandex.ru/get/110545/158289418.3a5/0_16d5f2_261f4f43_XL.png
Кушелев: Я так понял, что это сопоставление моей модели TFIIB с моделью из PDB

https://img-fotki.yandex.ru/get/194425/158289418.3a4/0_16b9a6_dd58245_XL.png
Модель комплекса из PDB


 ПИКОСОФТ СТАТЬИ, ПЕРЕПИСКА С CASP


[15:39:17] Кушелев Александр Юрьевич: Несколько кадров из анимации комплекса TBP1+DNA (электронный слой): http://nanoworld.org.ru/post/80544/#p80544

https://img-fotki.yandex.ru/get/40987/158289418.3a6/0_16d6d0_30af59fd_XL.pnghttps://img-fotki.yandex.ru/get/195990/158289418.3a6/0_16d6d1_ceac4eda_XL.pnghttps://img-fotki.yandex.ru/get/166616/158289418.3a6/0_16d6d2_b69904ab_XL.png

https://img-fotki.yandex.ru/get/30536/158289418.3a6/0_16d6d4_bf1a6764_XL.pnghttps://img-fotki.yandex.ru/get/30536/158289418.3a6/0_16d6d5_fe0d18a7_XL.pnghttps://img-fotki.yandex.ru/get/40987/158289418.3a6/0_16d6d6_44df52a6_XL.png

[15:44:34] Кушелев Александр Юрьевич: Тут ещё есть любопытный момент. В банке PDB в комплексе 1VOL показана общепризнанная, но неправильная модель ДНК. Там показаны 16 ступеней ДНК. В пикотехнологической модели комплекса TBP1+DNA (электронный слой) видно, что в белок входит фактически 2 (максимум 3) ступени ДНК. Таким образом можно констатировать факт, что по данным РСА размер ДНК определён с погрешностью типа 400%. Абсолютная ошибка превышает 10 ангстрем в длину участка ДНК.



Victoriy

Ещё один момент: АЮ не торопитесь с обнародыванием своей модели ДНК, Вы точно отпугнёте заказчицу. Если с белками как говориться бабушка на двое сказала: у каждого своя конформация, которая ещё может и видоизменяться в процессе функционирования. То в структуре ДНК не сомневается ни один биолог и Вам на слово никто не поверит. Кстати с Вашей "новой" моделью ДНК я тоже не могу согласиться.
Не надо загружать заказчика Вашими подробностями и трудностями. Сейчас модели белков, нуклеиновых кислот, лигандов вручную никто не совмещает (это дилетантство), обычно используют метод виртуального молекулярного докинга. (дружеский совет во благо)


Victoriy

Вопрос к А.Ю.: Ваш файл pdb для нуклеотидной последовательности соответствует общепринятой последовательности атомов в нуклеотиде? Если да, то я буду тоже ориентироваться на данную нумерацию и последовательность атомов, если Вы не сверяли, то это придётся уточнять для однозначного воспроизведения координатных файлов нуклеиновых кислот вьюерами.


Victoriy пишет:

Вопрос к Андрею: Вы порекомендовали заказчице покрутить мои модели в Молекулярной Динамике? Мне кажется, что после такой процедуры сходство с моделями, построенными по данным РСА, должно стать ещё больше.

Предложение для А.Ю. и Андрея: посмотрите в архиве Наномира мои публикации по пикотехнологии (там и про углы, и про карты Рамачандрана, и что самое главное на языке биологии).

Кушелев: Самое лучшее - это книга "Пикотехнология белков". Андрей хочет прочитать эту книгу.


Формы, механизмы, энергия наномира. Сообщение 83 096

Victoriy пишет:

Сейчас модели белков, нуклеиновых кислот, лигандов вручную никто не совмещает (это дилетантство), обычно используют метод виртуального молекулярного докинга. (дружеский совет во благо)

Кушелев: Отлично! Значит достаточно передать заказчику PDB-файлы белков и ДНК, и метод молекулярного докинга сделает своё дело.

Что касается

Victoriy пишет: Вашей "новой" моделью ДНК я тоже не могу согласиться.

то эта модель ДНК была создана в 2011 году. Сегодня я планирую создать окончательный PDB-файл двухцепочечной пикотехнологической модели РНК / ДНК (ядерный слой), который можно будет отослать заказчику для совмещения с моделями белков комплекса 1VOL.

Как видите, в среде 3DS Max модель ДНК идеально совместилась с моделью белка TBP1. Кстати, Вы тоже можете попробовать совместить Ваши модели белков и ДНК. Вдруг они у Вас тоже идеально совместятся smile

https://img-fotki.yandex.ru/get/194425/158289418.3a6/0_16d75b_ac62a198_XL.png
Анимировать: https://cloud.mail.ru/public/Ft3F/o4v8jS5ov

Совмещение пикотехнологической модели ДНК (ядерный слой) с пикотехнологической моделью белка TBP1. Отчётливо видно сопряжение на уровне трёх ступеней ДНК.

https://img-fotki.yandex.ru/get/30536/158289418.3a6/0_16d6d4_bf1a6764_XL.png
Анимировать: https://cloud.mail.ru/public/Ft3F/o4v8jS5ov

Совмещение пикотехнологической модели ДНК (электронный слой) с пикотехнологической моделью белка TBP1


Victoriy пишет:

Вопрос к А.Ю.: Ваш файл pdb для нуклеотидной последовательности соответствует общепринятой последовательности атомов в нуклеотиде? Если да, то я буду тоже ориентироваться на данную нумерацию и последовательность атомов, если Вы не сверяли, то это придётся уточнять для однозначного воспроизведения координатных файлов нуклеиновых кислот вьюерами.

Кушелев: Я взял из базы PDB-файл с ДНК и просто поменял координаты.


Формы, механизмы, энергия наномира. Сообщение 83 100

Skype, 2016-12-19:

[16:18:31] Andrei: так подождем до второй модели?
[16:26:39] Кушелев Александр Юрьевич: Вообще-то и первая модель белка - гарантия успеха
[16:27:36] Кушелев Александр Юрьевич: Так что можно посылать 4 ролика анимации, а PDB-модель нужно смасштабировать на коэффициент 0.6 Лучше это сделать самим.
[16:27:53] Кушелев Александр Юрьевич: Жаль, что программист занят. Он бы это сделал за 5 минут
[16:28:05] Andrei: не проблема, подождем
[16:28:57] Кушелев Александр Юрьевич: Через час-два попробую разобраться со вторым белком
[16:29:19] Кушелев Александр Юрьевич: Он не такой очевидный, а в базе данных PDB вообще "полный привет" smile
[16:30:04] Кушелев Александр Юрьевич: Там альфа-спирали нарисовали "как бог на душу положит", а модель ДНК с неправильной ориентацией ступеней, поэтому короче в 4 раза smile
[16:30:21] Andrei: https://cloud.mail.ru/public/5j2J/R81Y4QJjC
[16:30:29] Andrei: это не работает
[16:30:41] Andrei: и вторая тоже
[16:30:48] Кушелев Александр Юрьевич: Я заменил 2 ролика на 4
[16:30:51] Andrei: аа
[16:31:06] Кушелев Александр Юрьевич: Названия поменялись, поэтому я старые два стёр
[16:31:19] Andrei: надо было тут тоже стереть
[16:31:26] Кушелев Александр Юрьевич: ОК
[16:31:33] Кушелев Александр Юрьевич: Исправлюсь в будущем
[16:31:45] Кушелев Александр Юрьевич: Появлюсь через час-два
[16:34:46] Andrei: может там надо подписать в видео что там что?
[17:59:16] Кушелев Александр Юрьевич: Там в названии подписано
[17:59:36] Andrei: ну пусть так
[18:00:05] Кушелев Александр Юрьевич:
[16:28:20] Кушелев Александр Юрьевич: Привет! А ты можешь все координаты в PDB-файле умножить на 0.6 ?
[17:43:34] Va12220(valqwa): МОГУ )
сегодня как доеду и вспомню - то сделаю
[18:00:37] Andrei: отлично
[19:00:33] Кушелев Александр Юрьевич: Комплекс TBP1+DNA идеально вложился в полость белка TFIIB smile
Сейчас компьютер делает анимацию.
[19:00:42] Andrei: супер
[19:01:55] Кушелев Александр Юрьевич: Виктория написала на форуме, что против моей модели ДНК. Интересно будет посмотреть, как вставится в комплекс модель ДНК от Виктории. Она пыталась сделать свою модель ДНК максимально приближенной к общепринятой, т.е. из банка PDB
[19:27:43] Кушелев Александр Юрьевич: Это ещё один ролик с TBP1, но без электронного слоя. Так больше видно. https://cloud.mail.ru/public/BR8K/MoUHKhtG5
[19:28:10] Кушелев Александр Юрьевич:

А это ролик всего комплекса 1VOL:

https://cloud.mail.ru/public/5eaU/5T7v7mCwM

https://img-fotki.yandex.ru/get/49312/158289418.3a6/0_16d828_a1b23880_XL.png
[19:29:15] Кушелев Александр Юрьевич: Короче, ДНК вставляется в маленький белок TBP1, а он в свою очередь вставляется в полость более крупного белка TFIIB
[19:31:07] Кушелев Александр Юрьевич: Конечно, нужно ещё применить инструмент "молекулярная динамика", чтобы из жесткой геометрической модели получить гибкую физическую, но это уже профессионалы разберутся smile
[19:36:57] Кушелев Александр Юрьевич: Кстати, Виктория написала на форуме, что совмещение белков автоматизировано. Так что наш заказчик может самостоятельно совместить PDB-файл модели DNA/RNA с моделью белка TBP1, а потом совместить этот комплекс с белком TFIIB. Технологию молекулярной динамики нужно будет применить сначала после, а потом до совмещения. Если молекулярная динамика на уровне нанотехнологии портит пикотехнологические модели, то применение до совмещения даст хуже результат совмещения.
Кстати, комплекс 1VOL похож на 3 матрёшки. Самая маленькая - ДНК, вторая - белок TBP1, а самая большая - белок TBIIB
[19:37:43] Andrei: так ее модель тоже подошла?
[19:38:59] Кушелев Александр Юрьевич: Виктории? Это мы скоро узнаем smile
[19:39:03] Andrei: молекулярная динамика это известное что-то всем?
[19:39:10] Кушелев Александр Юрьевич: Да
[19:39:21] Кушелев Александр Юрьевич: Программа PyMol её может делать
[19:39:49] Кушелев Александр Юрьевич: У Виктории и у заказчика она есть, а у меня была, но сейчас нет
[19:40:19] Кушелев Александр Юрьевич: Для неё желательно отдельный компьютер иметь, иначе может всё посыпаться...



Andrei01 пишет:Victoriy пишет:

Вопрос к Андрею: Вы порекомендовали заказчице покрутить мои модели в Молекулярной Динамике? Мне кажется, что после такой процедуры сходство с моделями, построенными по данным РСА, должно стать ещё больше.

Виктория, а вы можете примеры привести, что сходство увеличится? То есть разница в 18А там уменьшится?

Victoriy

Андрей, я уже Вам писала, что в отличие от Кушелева, моя программа моделирует не конечную конформацию белка, а его СТРУКТУРНЫЙ ШАБЛОН (хотя он оказался ближе к экспериментальным моделям, чем у А.Ю.). Т.е. это структура белка, которая синтезируется на рибосоме БЕЗ влияния микроокружения, но по собственному генкоду (точнее гену). В клетке после того, как структурный шаблон белка синтезирован он подвергается действию всевозможных физических сил (начиная от электростатических и заканчивая Ван-дер-вальсовыми). Этот процесс носит название фолдинг белка. Так вот, процесс фолдинга моего структурного шаблона в конечную конформацию белка можно смоделировать при помощи молекулярной динамики. Мы получим функциональную конформацию белка, которая будет сравнима с моделями, построенными по данным РСА. И разумеется разница в 16,5 Ангстрем должна в разы уменьшиться. А сейчас заказчик сравнивает жесткий скелет с гибким телом и естественно получает такие расхождения. Вот я и предлагаю заказчику самостоятельно превратить скелет в гибкое тело, удивиться и поверить в свой собственный результат, тем более, что нужен он ей, а не мне.

Victoriy А.Ю., обратите внимание, что Вы сделали модель комплекса с 3-мя нуклеотидами, вместо 16. И если в узле состыковки нуклеотидные хвосты не актуальны, то комплементарные пары нуклеотидов должны быть. Я так думаю:)

Andrei01

Виктория, хорошо. Напишу им об этом. Поэтому они и слали свои данные, чтобы мы поняли почему такое различие большое в 6 раз.

Формы, механизмы, энергия наномира. Сообщение 83 107

Victoriy пишет:

в отличие от Кушелева, моя программа моделирует не конечную конформацию белка, а его СТРУКТУРНЫЙ ШАБЛОН (хотя он оказался ближе к экспериментальным моделям, чем у А.Ю.)

Кушелев

Уважаемая Виктория! А Вы не могли бы осуществить автоматических докинг моделей белков TBP1 и TFIIB ?

Интересно посмотреть, состыкуются ли Ваши модели между собой и мои модели между собой автоматически?

Вручную у меня получилось: https://cloud.mail.ru/public/5eaU/5T7v7mCwM

https://img-fotki.yandex.ru/get/49312/158289418.3a6/0_16d828_a1b23880_XL.png

Теперь интересно проверить автоматизированный докинг. Насколько он работоспособен? smile

Кстати, непонятно, как Ваша программа строит 310-спирали? По Вашей таблице их в шаблоне быть не должно...

Victoriy пишет:

А.Ю., обратите внимание, что Вы сделали модель комплекса с 3-мя нуклеотидами, вместо 16. И если в узле состыковки нуклеотидные хвосты не актуальны, то комплементарные пары нуклеотидов должны быть. Я так думаю:)

Кушелев: Я специально убрал половину нуклеотидов, чтобы виднее было. А на модели, где показаны только ядра, ступени целые (пары нуклеотидов). В файле PDB тоже модель двойной ДНК, причём все 16 ступеней.

А заказчик может укорачивать и разбирать модель ДНК из PDB-файла по своему усмотрению.

Формы, механизмы, энергия наномира. Сообщение 83 109

Andrei01 пишет:

Виктория, хорошо. Напишу им об этом. Поэтому они и слали свои данные, чтобы мы поняли почему такое различие большое в 6 раз.

Кушелев: Самое интересное - провести автоматический докинг для комплекса 1VOL. Он должен дать разный результат для вариантов моделей Виктории Соколик и Александра Кушелева. Интересно же посмотреть, в каком варианте лучше состыкуются белки между собой и с ДНК smile


Victoriy

Увы, у меня пока нет навыков самостоятельного выполнения докинга, тем более 3 высокомолекулярных полимеров. С коллегами из Киева в этом году был сделан докинг куска из 63 а.о. белка предшественника амилоида (AбетаPP), содержащего сам бета-амилоидный пептид, с куркумином. Опубликовано в Advances in Biochemistry. – 2016. – V. 4, Is. 4. – P. 34-46.
Поэтому я и призываю в нашу команду биоинженера/молекулярного биолога с опытом работы в молекулярном моделировании.


Кушелев: А может быть программы типа PyMol могут автоматически выполнять докинг двух белковых молекул?


Victoriy

Мы использовали инструмент CCDC GOLD Suite 5.1 для докинга и его же оценочные функции для характеристики устойчивости комплекса. Для меня PyMol не более чем вьюер.


Татьяна Рясина

На сегодняшний день мы стали проще относиться к идолу РСА в результате продолжительной беседы.

Почему бы не выработать отношение попроще и к идолу ДНК?

Вот допустим ответы по задачке заказчицы готовы, пусть они даже отправлены.

Можно же написать что-то вроде, вдогонку:
Позвольте ознакомить Вас с нашей критикой общепринятой модели ДНК
Мы провели моделирование ДНК методами Пикотехнологии.
Наши поправки по алгоритмам Пикотехнологии выявили следующие различия с общепринятой моделью /....../
Корректность наших поправок подтверждается тем что /...../
В дополнении к только что решённой нами для Вас задаче и при совмещении полученной структуры и нашей модели ДНК мы получим следующее /......./ Таким образом /......./

И ещё вопрос к уважаемым изобретателям Пикотеха:
кто напишет в Германию в лабораторию которая увидела электроны-колечки на АСМ
про то что:
1) мы занимаемся моделированием атомов, молекул и молекулярных структур с помощью модельного представления об электронов как о закольцованных стоячих волнах (ссылки)
2) Ваша работа подтверждает эти модели
3) Мы разработали Пикотех для моделирования белковых структур
3) Проверьте пожалуйста базовые структуры белков экспериментально (список наименований, дизайн эксперимента)

Андрей и Виктория, вы можете сформировать максимально полый список критики,  вопросов, опровержений и пр. по модели ДНК А.Ю., чтобы в итоге получить хорошую аргументацию в её пользу...


Кушелев

Всё это актуально, но сложно на уровне голого энтузиазма. Нужно найти заинтересованных людей, которые продвинут новое научное направление "по полной программе". Ведь пикотехнология белков была создана уже в 1993-ем году, а развивается она без нормального финансирования "черепашьими шагами"...



Victoriy пишет:

А.Ю., мне интересно: в Вашей модели комплекса последовательность нуклеотидов не имеет значение?

Кушелев: Нет, конечно. Если комплекс занимается транскрипцией ДНК, то он должен одинаково хорошо заниматься транскрипцией любых последовательностей.

Кстати, ключевые аминокислотные остатки как бы прикасаются к центральным зонам соседних ступеней ДНК:

https://img-fotki.yandex.ru/get/197102/158289418.3a6/0_16d875_2ffb2fe9_XL.png


Skype:

[19.12.2016 19:44:15] Andrei: Щас попробую все оформить и послать им
[19.12.2016 19:47:32] Кушелев Александр Юрьевич: Скоро приедет домой программист. Тогда будет нормальный PDB-файл DNA / RNA
[19.12.2016 19:56:12] Andrei: а, я думал уже готово
[19.12.2016 19:56:42] Andrei: А это ролик всего комплекса 1VOL:
[19.12.2016 20:00:15] Кушелев Александр Юрьевич: Ролик-то готов, а PDB-файл ДНК/РНК ещё не готов
[19.12.2016 20:01:58] Andrei: Книга вроде 74 евро стоит
[19.12.2016 20:02:20] Кушелев Александр Юрьевич: Да. Электронный вариант 6 USD
[19.12.2016 20:02:31] Andrei: там не было электронного варианта
[19.12.2016 20:02:48] Кушелев Александр Юрьевич: У авторов есть
[19.12.2016 20:04:45] Andrei: как называется ядерный слой на английском?
[19.12.2016 20:05:23] Кушелев Александр Юрьевич: nuclear
[19.12.2016 20:05:56] Andrei: nuclear layer?
[19.12.2016 20:06:15] Кушелев Александр Юрьевич: Да. В файлах подписано nuclear и electronic
[19.12.2016 20:06:34] Andrei: ок
[19.12.2016 20:06:59] Andrei: Файлы лучше загружать на dropbox
[19.12.2016 20:07:36] Andrei: а то сайт на русском, они не поймут
[19.12.2016 20:08:29] Кушелев Александр Юрьевич: Загрузите, если сможете smile
[19.12.2016 20:08:42] Andrei: загружаю
[19.12.2016 20:08:44] Кушелев Александр Юрьевич: Или в письмо вложите
[19.12.2016 20:09:05] Andrei: в письмо не получится, тот сайт на русском
[19.12.2016 20:09:29] Кушелев Александр Юрьевич: Вы тогда ссылочку на эти файлы в dropbox опубликуйте, чтобы англоязычные читатели форума тоже смогли скачать и изучить.
[19.12.2016 20:09:46] Кушелев Александр Юрьевич: Сами файлы в письмо можно вложить по любому
[19.12.2016 20:10:04] Andrei: нет конечно, почта не пропустит
[19.12.2016 20:10:34] Andrei: я не даю ссылки для всех
[19.12.2016 20:11:13] Кушелев Александр Юрьевич: Только русскоязычным разрешаете файлы скачивать? wink
[19.12.2016 20:11:33] Andrei: там настройки есть
[19.12.2016 20:11:40] Кушелев Александр Юрьевич: Ушлые китайцы всё-равно с облака мэйл ру скачают smile
[19.12.2016 20:11:40] Andrei: надо настраивать специально
[19.12.2016 20:45:19] Andrei: так у вас тоже не учитываются силы на белок как у Виктории?
[19.12.2016 20:49:08] Кушелев Александр Юрьевич: Мой алгоритм пока реализован на геометрическом уровне, но генетический код дублирует физико-химические взаимодействия, поэтому подавляющее большинство участков белковых молекул не модифицируются после рибосомальной сборки белка. А те, которые модифицируются, можно смоделировать по дополнительной информации. Бывают и редкие случае, когда "всё сложно"
[19.12.2016 20:50:41] Кушелев Александр Юрьевич: В нашем случае 1VOL похоже, что белки не модифицируются, но в нормальных условиях они могут гнуться, защёлкиваться и т.д. Так что по хорошему учитывать физику и химию нужно.
[19.12.2016 20:50:57] Кушелев Александр Юрьевич: Это уже проблема заказчика.
[19.12.2016 20:51:30] Кушелев Александр Юрьевич: Если нам закажут исследование динамики белка, тогда это будет уже "совсем другая песня" и "совсем другие деньги"
[19.12.2016 20:51:58] Andrei: а почему же тогда оно налезло друг на друга само?
[19.12.2016 20:52:52] Кушелев Александр Юрьевич: Исследователи белков могут выращивать кристаллы в разных условиях, добиваясь фиксации молекул в разных состояниях. В результате они могут получить "фотки" в разных положениях частей молекулы белка.
[19.12.2016 20:53:38] Кушелев Александр Юрьевич: В нашем случае ДНК и белки совместились, т.к. их форма сильно не меняется после сборки рибосомой
[19.12.2016 20:54:09] Кушелев Александр Юрьевич: А бывают белки, которые надкусываются, из кусков собираются крупные агрегаты и т.д.
[19.12.2016 22:50:42] Кушелев Александр Юрьевич: Программист ещё едет домой smile
[19.12.2016 22:50:59] Кушелев Александр Юрьевич: А Вы аннотацию к книге "Пикотехнология белков" заказчику посылали?
[19.12.2016 22:51:01] Кушелев Александр Юрьевич:
The greatest enemy of knowledge is not ignorance, it is the illusion
Stephen Hawking
Sokolik VV, Kushelev AY
Geometry live nanoworld. Pikotechnology proteins / VV Sokolik, AY Kushelev. -
Kharkov: Publishing, 2015. – 255 p.

ISBN 978-3-659-92862-8

The monograph is devoted to the 3D-structure of molecules and polymers in
living systems. The analysis of the modern understanding of the fundamental concepts
of the physical volume of the atom, chemical bonding, and the genetic code is
presented. Based on statistical analysis of the experimental data on the protein structure
is justified coding secondary structure and structural polypeptide template of protein
in the genome. Propose additions table of the genetic code of proteins and peptides,
which formed the basis of the geometric algorithm software decoding structural
template protein, are Molecular Constructor and Picotex. The hypothesis of recoding
information to third nucleotide codon in the corresponding peptide bond rotamer directly
3D-structure isoacceptors tRNA is formulated. Mathematical analysis of contingency
angles φ and ψ (Ramachandran map) revealed their frequency changes as
possible to substantiate the mechanism of post-translational protein folding.
The book is intended for professionals involved in research in the field of molecular
biology, bioinformatics, biochemistry and biophysics.
Table: 36. Ill: 117. Refs: 227 titles.
[19.12.2016 22:51:40] Andrei: Ну как доедет, не горит)
[19.12.2016 22:51:52] Andrei: Посылал
[19.12.2016 22:52:12] Кушелев Александр Юрьевич: А рецензии?
[19.12.2016 22:52:14] Кушелев Александр Юрьевич: http://nanoworld.org.ru/topic/1150/
[19.12.2016 22:52:26] Кушелев Александр Юрьевич: Это самое научное...
[19.12.2016 22:56:29] Andrei: тоже, это все теория
[19.12.2016 22:56:34] Andrei: нужны примеры
[19.12.2016 22:57:52] Кушелев Александр Юрьевич: Какая же теория, когда речь идёт о модельных экспериментах, подтверждённых в 2015-ом году натурными (АСМ)?
[19.12.2016 22:58:15] Andrei: на практике нет применений
[19.12.2016 22:59:20] Кушелев Александр Юрьевич: Пикотехнология белков - это и есть практическая технология, которая базируется на модельных экспериментах теперь уже подтверждённых прямыми экспериментами (АСМ)
[19.12.2016 23:00:00] Andrei: коммерческой прибыли нет от этого на практике
[19.12.2016 23:00:05] Andrei: надо искать
[19.12.2016 23:01:25] Кушелев Александр Юрьевич: Виктория пишет, что не владеет программой, где делается автоматический докинг. Может быть имеет смысл попросить заказчика применить автоматический докинг для сравнения моделей белков и ДНК от Кушелева и Соколик?
А раз заказчик может сравнивать модель Кушелева с моделью из PDB, значит сможет сравнить и модель Кушелева с моделью Соколик. Интересно, на сколько ангстрем отличаются наши модели?
[19.12.2016 23:01:36] Кушелев Александр Юрьевич: Прибыль будет, не торопитесь.
[19.12.2016 23:01:52] Andrei: ничего просить не можем
[19.12.2016 23:02:22] Кушелев Александр Юрьевич: А предлагать?
[19.12.2016 23:02:31] Andrei: покажем идеи а дальше если стоящая то может быть сможет найти практическое применение
[19.12.2016 23:03:24] Кушелев Александр Юрьевич: Они же сами заинтересованы сделать модель комплекса 1VOL. Если они умеют делать автоматический докинг, то смогут попытаться сделать его в варианте моделей Кушелева и Соколик. В одном из вариантов должно получиться лучше.
[19.12.2016 23:03:38] Кушелев Александр Юрьевич: У меня вручную получилось, а у них автоматически должно получиться.
[19.12.2016 23:04:04] Andrei: зачем им это
[19.12.2016 23:06:16] Кушелев Александр Юрьевич: Их цель, как я понял, выяснить механизм работы комплекса 1VOL
[19.12.2016 23:06:30] Кушелев Александр Юрьевич: Применить для этого автоматический докинг - сам бог велел smile
[19.12.2016 23:07:15] Кушелев Александр Юрьевич: А дальше они могут сравнить, какие модели лучше собираются в "матрёшки", от Кушелева или от Виктории. Они же рассчитали 18 и 16.5 ангстрем?
[19.12.2016 23:07:20] Кушелев Александр Юрьевич: Значит нужно.
[19.12.2016 23:07:30] Andrei: что дает докинг?
[19.12.2016 23:08:04] Кушелев Александр Юрьевич: Автоматическую сборку "матрёшки". Я-то делал вручную. Интересно получится та же структура в автоматическом режиме?
[19.12.2016 23:08:36] Andrei: пусть сначала это посмотрят
[19.12.2016 23:08:46] Andrei: посмотрим что скажут
[19.12.2016 23:08:47] Кушелев Александр Юрьевич: Безусловно



Skype, 2016-12-20:

[0:33:35] Кушелев Александр Юрьевич: Программист добрался до дома. Сказал, что сейчас сделает PDB-файл ДНК
[0:52:15] Кушелев Александр Юрьевич: Файл готов: http://nanoworld.org.ru/post/80584/#p80584

https://img-fotki.yandex.ru/get/196161/158289418.3a6/0_16d877_bbba6c36_XL.png

https://img-fotki.yandex.ru/get/195125/158289418.3a6/0_16d878_6d535a5d_XL.png

PDB-файл: https://cloud.mail.ru/public/LNUH/7JNWA75Nk



ОБНАРУЖЕНА ОШИБКА В ПРОГРАММЕ, ИСПРАВЛЯЕМ   1 ,  2


aest пишет:

вы пытались продавать наивным биологам ваши модели белков по 10000 уе, заверяя о пикоточности в то время, как у вас в алгоритме ошибка была ? Некрасиво как-то получается.

Кушелев: Конечно некрасиво. Поэтому пытаемся исправить ошибку, но это дело непростое... Углы уже удалось исправить, но в программе Дениса Савина где-то ещё запрятаны смещения. Ищем smile





Кодируется ли тип спиралей белков композиционным генетическим кодом? Точность и стоимость РСА. Самоповерка пикотехнологии.

Kushelev пишет:Victoriy пишет:

третий нуклеотид кодонов детерминирует лишь один из трех разновидностей вторичных структур в белке: спираль, бета-тяж или поворот. За разновидности спиралей отвечает специфика хвостов аминокислотных остатков в них входящих. А это уже не к коду, а к фолдингу.

Кушелев: Тут интересно было бы разобраться подробнее. Вот типовой участок 310-спирали:

http://nanoworld88.narod.ru/data/209_files/0_48027_3b50efe_orig.gif
Мы видим коды 310-спирали (N4) по моей таблице композиционного генетического кода: http://nanoworld88.narod.ru/data/212.htm

Вы не могли бы с помощью своего алгоритма построить участок структуры белка по входным данным:

FT   CDS 1..48
gctctgctgc tgctggcgtc ggcgctgctc gtgtcgctga cgcacaca
//

Очень интересно посмотреть, получится ли по Вашему алгоритму 310-спираль этого белка (гонадотропина)?

Я предполагаю, что Ваш алгоритм выдаст вместо 310-спирали альфа-спираль...

Милейший Александр Юрьевич, мы так долго и упорно это обсуждали в своё время, что остались каждый при своём мнении, своей таблице и своей программе моделирования структуры белков. Не втягивайте меня в обсуждение снова. Если этот вопрос Вас не отпускает можно вернуться в архив форума и всё пересмотреть и даже пережить снова.


Victoriy пишет:

мы так долго и упорно это обсуждали в своё время, что остались каждый при своём мнении

Кушелев: Уважаемая Виктория! Я что-то не припомню, чтобы Вы строили модель и получали PDB-файл по этим данным:

FT   CDS 1..48
gctctgctgc tgctggcgtc ggcgctgctc gtgtcgctga cgcacaca

Не дадите ссылку?


Дело в том, что Андрей интересовался, в чём отличие наших с Вами алгоритмов. Я думаю, что на этом примере будет хорошо видно это отличие. Нужно только получить PDB-файл по этим данным с помощью Вашей программы. А я могу получить PDB-файл по этим же данным с помощью программы Пикотех.

***
Пример PDB-файла (фрагмент гонадотропина), полученного с помощью программы Пикотех:


http://img-fotki.yandex.ru/get/6300/126580004.51/0_bc7ac_b07933_L.gif


Цитата:

α-спираль, или спираль 413

310-спираль — очень «тугая» спираль, в сечении имеет форму треугольника, в белках встречается в основном её правая форма, и то только в виде 1-2 витков


Victoriy пишет:

А.Ю., Андрею ни холодно, ни жарко от нюансов отличий между нашими программами, а с Вами я не хочу повторно это обсуждать. Почитайте мою монографию, там всё очень подробно написано.

Кушелев: К сожалению, в книге нет модели 310-спирали, например, модели фрагмента гонадотропина, построенной с помощью Вашего алгоритма. Вот мне и хотелось бы увидеть, что же реально будет построено по Вашему алгоритму, если дать ему входные данные фрагмента гонадотропина:

FT   CDS 1..48
gctctgctgc tgctggcgtc ggcgctgctc gtgtcgctga cgcacaca
//

Давайте вместе посмотрим на результат работы Вашего алгоритма. А Вы его прокомментируете. Мне очень интересно узнать Ваши комментарии.

А у Андрея интерес не праздный. Его тоже спросят, почему два варианта PDB-файлов? В чём различие? Вот я и предлагаю наглядно показать различие на примере фрагмента гонадотропина. Ведь его структура надёжно установлена, т.к. длина 310-спирали существенно отличается от длины альфа-спирали. Это даже РСА "видит" smile



Kushelev пишет:

Цитата:

α-спираль, или спираль 413

310-спираль — очень «тугая» спираль, в сечении имеет форму треугольника, в белках встречается в основном её правая форма, и то только в виде 1-2 витков

Цитата-2: π-спираль, или спираль 516, — спираль с широкими витками, в результате в центре спирали остаётся пустое пространство. В белках встречается редко, обычно не более одного витка.

http://img-fotki.yandex.ru/get/6302/126580004.52/0_bcc2f_a96d98c5_M.gif
Подробнее: http://nanoworld.org.ru/topic/301/

Кушелев: Согласно моей таблице композиционного генетического кода пи-спираль (спираль 516) кодируется периодическим кодом 3333333333333

Такой код как раз встречается во входных данных белков TFIIB:

https://img-fotki.yandex.ru/get/117578/158289418.3a4/0_16bc45_ac39775f_XL.png

и TBP1:

https://img-fotki.yandex.ru/get/196161/158289418.3a4/0_16cb20_65b2de08_XL.png

Если в PDB-файле вместо пи-спирали у Вас что-то другое, то что? А если пи-спираль, то по какому алгоритму она получена, если не по моей таблице композиционного кода? smile


Участок белка TFIIB с 270 по 284 выделен зелёным цветом. На него указывают зелёные стрелки.

https://img-fotki.yandex.ru/get/194503/158289418.3a4/0_16cb4b_aa29efdf_XL.jpg

Мы видим, что по алгоритму Виктории Соколик тут получилась такая же 310-спираль в том числе и на участке, где по программе 2D нет никакой спирали. Вот мне и интересно, как же получена в 3D-алгоритме 310-спираль, если не по моей таблице композиционного генетического кода?


Skype, 2016-12-13:

[19:40:44] Andrei: интересно а как вообще фирмы для себя белок выбирают
[19:40:53] Andrei: например медицинские
[19:41:17] Andrei: сидят и гадают какой белок взять?
[19:42:09] Кушелев Александр Юрьевич: Там много всяких способов. Фармацевты иногда всё подряд проверяют. Генные инженеры комбинируют гены, биотехнологи модифицируют гены...
[19:42:36] Andrei: а как все подряд?
[19:42:41] Andrei: откуда берут белки?
[19:43:27] Andrei: надо же как-то синтезировать из кусков
[19:43:37] Andrei: кодировать
[19:43:56] Andrei: надо погуглить
[19:47:37] Кушелев Александр Юрьевич: В человеческом организме около 5 000 000 разных видов белков. А есть ещё в других организмах животных и растений. Вот все подряд и пробуют smile
[19:48:33] Andrei: а почему нельзя конструктор сделать из всех кодонов?
[19:48:38] Andrei: их же 20 всего
[19:49:40] Кушелев Александр Юрьевич: Можно. Я даже вручную делал: https://www.youtube.com/watch?v=nVYnVZv6Qr8
[19:49:58] Кушелев Александр Юрьевич: Эти модели были сделаны в 1992...1994 годах
[19:50:11] Andrei: я про настоящие smile
[19:50:24] Кушелев Александр Юрьевич: На них я как раз и составил таблицу композиционного генетического кода.
[19:51:00] Кушелев Александр Юрьевич: А из настоящих аминокислот белки собирает органелла клетки рибосома. По генетическому коду
[19:51:25] Andrei: ну вот, генетический код каждый раз новый подсовывать
[19:51:44] Кушелев Александр Юрьевич: Генные инженеры этим и занимаются
[19:52:14] Кушелев Александр Юрьевич: Но лучше сначала на компьютере через секунду результат увидеть, а если подходит, тогда уже синтезировать из настоящих
[19:52:28] Andrei: так а что там смотреть?
[19:52:38] Andrei: одни загуговины smile
[19:52:48] Кушелев Александр Юрьевич: Структуру. По ней можно догадаться, подойдёт нам этот белок или ну его...
[19:53:17] Andrei: как?
[19:53:20] Кушелев Александр Юрьевич: Для неспециалиста внешний вид экскаватора ничего не даёт. На крайний случай назовут камнеедом, если увидят в работе
[19:53:41] Кушелев Александр Юрьевич: А если на стоянке, то могут вообще не догадаться, что за хрень
[19:53:52] Andrei: на мохнатость структуры смотрят?
[19:54:16] Кушелев Александр Юрьевич: Там на всё смотрят. А я даже по звуку могу определить, где активные центры белка находятся
[19:54:27] Andrei: звуку чего?
[19:54:34] Кушелев Александр Юрьевич: По звуку сборки белка
[19:55:22] Andrei: откуда звук?
[19:55:36] Кушелев Александр Юрьевич: Аминокислоты при установке в белковую цепь отзванивают на своих частотах. Можете послушать звучание сборки активного центра белка коллагена: http://www.nanoworld.org.ru/data/01/data/sounds/c01.mp3
[19:56:18] Andrei: а на бояне кто там играет?
[19:56:23] Andrei: тоже белок?
[19:56:46] Кушелев Александр Юрьевич: Это моя аранжировка
[19:57:02] Andrei: так и не понял откуда частота взялась
[19:57:13] Кушелев Александр Юрьевич: Программа Пикотех выдаёт музыку в стандарте MIDI
[19:57:19] Andrei: аа
[19:57:50] Кушелев Александр Юрьевич: Частота рассчитывается по формуле Томсона для математического и пружинного маятников. По длине радикалов аминокислотных остатков
[19:57:58] Andrei: интересно
[19:58:08] Andrei: вот это может сработать
[19:58:24] Кушелев Александр Юрьевич: На эту тему была снята ТВ-передача "Музыка молекул" в 1992-ом году
[19:58:39] Кушелев Александр Юрьевич: Там ного чего уже сработало
[19:59:44] Кушелев Александр Юрьевич: Например, в 2015-ом году вышла статья физиков из Германии, где они "нащупали" с помощью АСМ (атомного силового микроскопа) кольцевые грани атомов: http://nanoworld88.narod.ru/data/493.htm
[20:00:15] Кушелев Александр Юрьевич: Это - экспериментальное подтверждение результатов моих модельных экспериментов.
[20:01:12] Кушелев Александр Юрьевич: Ну и не забывайте, что учебные пособия с пикотехнологическими моделями молекул и кристаллов уже изучают в школах России с 2004 года: http://nanoworld88.narod.ru/data/250.htm



[20:02:37] Andrei: о как
[20:02:41] Andrei: интересно
[20:02:56] Andrei: жаль пока приспособить некуда
[20:04:22] Andrei: так написано что Снельсон это изобрел
[20:06:50] Кушелев Александр Юрьевич: Снельсон открыл кольцегранный микромир уже в 1960-ом году. В 1963-ем вышла его первая статья с моделями атомов. Но ... до белков он не добрался.
[20:07:20] Кушелев Александр Юрьевич: А Збигнев Огжевальский доложил о кольцегранных моделях атомов, молекул и кристаллов ещё в 1957-ом.
[20:07:34] Кушелев Александр Юрьевич: Про Снельсона я узнал в 2003-ем, а про Огжевальского в 2007-ом.
[20:09:10] Кушелев Александр Юрьевич: Пикотехнология белков базируется на моём научном открытии композиционного генетического кода. Если найдёте ещё одного открывателя, который опубликовал таблицу композиционного генетического кода раньше меня, т.е. до 1992 года, то будет очень интересно smile
[20:10:18] Кушелев Александр Юрьевич: Таблица композиционного кода выделена голубым цветом. Публикация 1993 года:

http://nanoworld88.narod.ru/data/230_files/0_4a672_1493e464_XL.jpg



[20:12:40] Andrei: в чем открытие?
[20:12:49] Andrei: комбинация кодонов?
[20:17:14] Кушелев Александр Юрьевич: Открытие заключается в том, что три буквы кодируют не только аминокислоту, но и угол поворота этой аминокислоты относительно предыдущей:

http://nanoworld88.narod.ru/data/216_files/bio.gif

[20:17:59] Кушелев Александр Юрьевич: Этот угол (и формы аминокислот) как раз и открывают возможность определять структуры белков по таблице
[20:18:08] Andrei: а что не знали что углы есть?
[20:18:17] Кушелев Александр Юрьевич: Знали
[20:18:23] Кушелев Александр Юрьевич: Но не знали, что эти углы кодируются


[20:18:52] Andrei: то есть закручиваться по разному может спираль?
[20:19:55] Кушелев Александр Юрьевич: Куда аминокислоту повернули, туда и пойдёт расти белковая "цепь"
[20:20:13] Кушелев Александр Юрьевич: А там три крупных варианта поворота, т.е. через 120 градусов
[20:20:28] Кушелев Александр Юрьевич: Но есть нюансы, с которыми не соглашается Виктория Соколик.
[20:20:54] Andrei: почему только 3 угла?
[20:21:01] Andrei: кодонов ведь больше
[20:21:30] Кушелев Александр Юрьевич: Например, один из вариантов расщепляется ещё на три. Одиночный альфа-вариант, альфа-вариант в структуре альфа-спирали и альфа-вариант в структуре 310-спирали. Есть и другие нюансы, но не буду Вас перегружать smile
[20:21:41] Кушелев Александр Юрьевич: Кодонов 64
[20:22:06] Кушелев Александр Юрьевич: Они кодируют 23 аминокислоты, если считать изомеры
[20:22:17] Andrei: так на каждый кодон свой угол?
[20:22:20] Кушелев Александр Юрьевич: Но для этого достаточно всего двух букв
[20:22:27] Кушелев Александр Юрьевич: Почти на каждый
[20:22:59] Кушелев Александр Юрьевич: Есть кодон-терминатор, который означает конец строительства белковой молекулы. Таких даже два разных.
[20:23:23] Andrei: на что влияет угол?
[20:24:20] Кушелев Александр Юрьевич: В таблице моё открытие выделено зеленым цветом:

http://nanoworld88.narod.ru/data/302_files/0_bcbf2_14392c02_orig.png

[20:24:33] Кушелев Александр Юрьевич: Угол влияет на направления роста структуры белка
[20:24:43] Andrei: всего 4 угла?
[20:26:08] Кушелев Александр Юрьевич: Их гораздо больше, но у Виктории в таблице 3 варианта, у меня 4, а в алгоритме Пикотехнология в данный момент 5.
[20:26:46] Кушелев Александр Юрьевич: Более того, некоторые из углов, например, в иминокислоте пролин могут сильно меняться, т.е. на десятки градусов.
[20:28:32] Кушелев Александр Юрьевич: Но пока я работаю по упрощённому алгоритму, т.е. без учёта физико-химических взаимодействий. Но даже на этом уровне результаты очень близки к реальности. А связано это с тем, что композиционный генетический код в процессе эволюции стал дублировать физико-химические взаимодействия на подавляющем большинстве участков белка.
[20:29:35] Andrei: должно быть какое-то практическое применение кроме красивости
[20:30:10] Andrei: чтобы можно было как-то свойства прогнозировать
[20:32:36] Кушелев Александр Юрьевич: Так практическое применение и заключается в том, что по старой технологии нужно заплатить 10 000 евро и ждать месяцы или годы, чтобы увидеть 3D-структуру белка, входящего в 3%, которые кристаллизуются.
[20:33:25] Кушелев Александр Юрьевич: А по новой технологии даёте нуклеотидную последовательность, и через секунду смотрите структуру любого, т.е. 3%+97% белка, причём в 1000 раз точнее.


Татьяна Рясина пишет:

Значит Пикософт видит участки, которые не видит и не показывает РСА?
Т.е. Пикософт показывает "белые пятна"или "пустые зоны" РСА?

Кушелев: Начну с того, что РСА применим только к кристаллам, т.е. 97% белков РСА вообще "не видит" smile

Из структур 3% белков, которые кристаллизуются, начальные и конечные участки до 50 аминокислотных остатков (до 1000 атомов) РСА тоже "не видит".

На примере ряда белковых структур мы видим, что РСА часто(!) не позволяет определить даже тип белка, т.е. может показать много альфа-спиралей, где их нет вообще или не показать там, где их много.

Реальная погрешность РСА - это габарит белковой молекулы. Чем крупнее молекула, тем больше возможная погрешность РСА. Но бывают и "счастливые случаи", когда по ряду дополнительных данных удаётся однозначно определить структуру белковой молекулы. Например, установлено, что инсулин состоит из двух гнутых участков спирали. Пикотех это подтверждает на все 100%


http://img-fotki.yandex.ru/get/5414/126580004.3d/0_b0f20_2c87f90a_orig.gif  

Подробнее: http://nanoworld.org.ru/topic/199/page/43/ , http://nanoworld88.narod.ru/data/276.htm
Эти два участка спиралей соединяются ещё на стадии проинсулина.



РСА (ЧЕРЕЗ ПОИСК ФОРУМА ЛАБОРАТОРИИ НАНОМИР)

http://nanoworld.org.ru/search/1376839994/ 

Рентгенограммы РСА 

Результаты анализа рентгенограмм РСА 

97% белков не кристаллизуеся. Системные ошибки РСА 

РСА может показать чего нет и не показать что есть  

РСА цены   ,   , 

Точность РСА   ,   ,   ,     ,  

Корреляция данных РСА с Пикотех  

РСА стремится к Пикотех 

Лауэграммы и ренгенограммы  ,  

Молекула лизоцима 




http://www.vokrugsveta.ru/telegraph/theory/1071/

https://img-fotki.yandex.ru/get/194492/158289418.3a7/0_16df1f_9732efdb_XL.jpg
Цитата: Фотоотчет о выращивании белковых кристаллов на МКС во время 12-й экспедиции с 1 октября 2005 по 8 апреля 2006 года. Рост одного кристалла занимал 25 дней. Фото: NASA


Skype, 2016-12-21:

[20:05:27] Кушелев Александр Юрьевич: 500 000 / 120 = 4167 USD за один кристалл белка. Добавьте сюда сопутствующие работы, например, собственно РСА и анализ данных.
[21:04:47] Кушелев Александр Юрьевич: Вам эти фразы должны понравиться:

https://img-fotki.yandex.ru/get/61266/158289418.3a7/0_16df20_8cf98a5a_XL.jpg
"из невразумительных точек и кругов с помощью специальных математических преобразований получают информацию о расположении атомов. Для неспециалистов выглядят как шарлатанство. Даже если решетка несложной формы, эта задача непростая, но все честно." Подробнее: http://www.vokrugsveta.ru/telegraph/theory/1071/
[21:09:54] Кушелев Александр Юрьевич: При большом везении при переборе 600 условий кристаллизации найдется 1–2 раствора, в которых появятся кристаллы. Как правило, на первом этапе они небольшие, непрозрачные и совершенно неправильной формы, то есть не подходящие для рентгеноструктурного анализа.
[21:15:41] Кушелев Александр Юрьевич: Вот ещё цитата о цене белкового кристалла:  На получение одного кристалла белка ученые могут потратить десятки тысяч евро, а фармацевтические компании готовы заплатить еще большие деньги за подробную информацию о структуре какого-нибудь важного для медицины белка — «замка», к которому можно подбирать «отмычку» — лекарство.


Skype, 2016-12-21:

[19:54:52] Кушелев Александр Юрьевич: Например, узнайте цену структуры белка, кристалл которого нужно выращивать 2 года smile
[19:55:12] Andrei: речь не обо мне а о вас, знаете ли вы цену или просто придумываете smile
[19:59:00] Кушелев Александр Юрьевич: Мне сказали цену специалисты из лаборатории РСА
[19:59:15] Кушелев Александр Юрьевич: Кстати, почитайте ещё раз, как проводится анализ: http://bio.1september.ru/view_article.php?ID=200900401
[20:00:25] Andrei: Сказать это одно, а заказать другое:)
[20:01:35] Кушелев Александр Юрьевич: Вот сюда позвоните и спросите, сколько будет стоить кристаллизация белка (минимум и максимум): http://www.piboc.dvo.ru/structure/ext_l … ristal.php
[20:03:14] Andrei: Ладно, это мелочь
[20:03:31] Andrei: Надо искать кому это нужно и зачем
[20:03:46] Кушелев Александр Юрьевич: Вот Вам конкретные данные:  "со ста двадцатью образцами работа еще даже не начиналась. На их восстановление потребуется не меньше полумиллиона долларов и от нескольких недель до нескольких месяцев работы." Подробнее: http://www.vokrugsveta.ru/telegraph/theory/1071/
[20:04:08] Кушелев Александр Юрьевич: 120 кристаллов белка - 500 000 долл.
[20:05:27] Кушелев Александр Юрьевич: 500 000 / 120 = 4167 USD за один кристалл белка. Добавьте сюда сопутствующие работы, например, собственно РСА и анализ данных.

https://img-fotki.yandex.ru/get/55431/158289418.3a7/0_16df1e_482d1979_XL.jpg



Татьяна Рясина пишет:

Прямые белки бывают или они обязаны быть спиральными?

Структура белковых молекул программируется:

http://img-fotki.yandex.ru/get/9229/158289418.af/0_ae26a_4c84e562_S.gif
Белок собирается из таких "кирпичиков"-аминокислот.

Подробнее: http://nanoworld.org.ru/topic/301/

Если они складываются в регулярную структуру, то получается альфа-, бета-, пи-, 310-спираль, которые кодируются соответственно композиционными кодами: 11111, 22222, 33333, 44444

Если же композиционные коды идут "в разнобой", то формируется произвольная "ломаная". Эта "ломаная" может, например, замкнуться в цикл с помощью дисульфидного мостика

Подробнее: http://nanoworld88.narod.ru/data/025.htm



Victoriy пишет:

Чтобы вторичная структура белка в виде 3/10 спирали была стабильна, и вообще сформировалась кодоны 4 должны идти хотя бы тройками подряд, чего вообще не наблюдается.

Кушелев: Вовсе нет. Чередование композиционных кодов "1" и "4" приводит лишь к изгибам спирали. Ведь она стабилизирована водородными связями. При этом стабильны и прямые спирали (альфа- и 310-), и изогнутые участки с любой комбинацией кодов "1" и "4". Я же Вам показал, как выглядят комбинированные, т.е. гнутые спирали:

Kushelev пишет:

Есть прямые альфа-спирали, где все композиционные коды 11111111111111111

Есть прямые 310-спирали, где все коды 4444444444444444

А большинство спиральный участков гнутые. Там коды 1 и 4 чередуются. При этом структура часто бывает периодической типа 114114114114 или 144144144144 или 111411141114

Я показывал в рассылке типовые гнутые спирали с периодическими кодами:

http://nanoworld88.narod.ru/data/298_files/0_7d8ff_4b6b2520_orig.gif

http://nanoworld88.narod.ru/data/298_files/0_7d948_be62fe10_M.jpg
Подробнее: http://nanoworld88.narod.ru/data/298.htm

http://nanoworld88.narod.ru/data/310_files/0_7da25_d7edb744_L.jpg
Подробнее: http://nanoworld88.narod.ru/data/310.htm

http://nanoworld88.narod.ru/data/209_files/0_47daa_bdcbb03_L.gif
Подробнее: http://nanoworld88.narod.ru/data/209.htm

Цитата: Как видите, плавные изгибы спирали белка можно направлять в любую сторону.


http://nanoworld.org.ru/post/80866/#p80866
diprospan:
ангиотензин
http://www.chem.msu.ru/rus/theses/2015/ … lltext.pdf
Кушелев:
Нужно будет сделать модели белков из этой диссертации

там рассматриваются вполне конкретные прикладные вещи и задачи.
прежде всего, важность АПФ (АНГИОТЕНЗИН-ПРЕВРАЩАЮЩЕГО ФЕРМЕНТА) и его критическая роль в
ренин-ангиотензин-альдостероновой системе и регуляции сердечно-сосудистой физиологии и
заболеваний, лекарства, блокирующие различные компоненты этой системы, эффективны при лечении
гипертензии, сердечной недостаточности и предупреждении сердечно-сосудистых событий, вызванных
атеросклерозом (в основном инфаркта и инсульта), а также способные замедлять болезнь почек,
вызванную гипертензией и диабетом.

Группа ингибиторов АПФ представлена широким спектром препаратов, наиболее важное значение для
клинической практики сохраняют ингибиторы - каптоприл, эналаприл и лизиноприл, как наиболее
изученные в многочисленных экспериментальных и клинических исследованиях.
а поиск и исследование более совершенных природных и синтетических ингибиторов АПФ на данный
момент является весьма актуальной задачей.

Анализ аминокислот, участвующих в процессе «открывания» и «закрывания» активного центра АПФ
авторами был осуществлён с использованием программы DynDom, доступной по адресу:
http://www.cmp.uea.ac.uk/dyndom/main.jsp
http://fizz.cmp.uea.ac.uk/dyndom/dyndomMain.do
Структура С-домена АПФ содержит 27 спиралей: 20 α-спиралей и 7 310-спиралей.
N-домен АПФ состоит из 18 α-спиралей, пяти 310-спиралей.
есть гипотеза что именно 310-спирали "акцепторны" к воздействию ингибиторов типа каптоприла и т.п.

http://s1.bild.me/bilder/240416/1256582imgs2.jpg http://s1.bild.me/bilder/240416/2351109imgs1.jpg

http://www.rcsb.org/pdb/explore/explore … ureId=1O8A

http://www.uniprot.org/uniprot/P12821

http://www.ebi.ac.uk/ena/data/view/AAA5 … play=fasta

Благодаря Diprospan, который сделал очень удачный подарок к Новому Году, мы с вами наблюдаем 310-спираль рекордной длины (17 аминокислотных остатков!), т.е. почти 6 полных витков 310-спирали.

"Такого я не видела..."


Формы, механизмы, энергия наномира. Сообщение 83 417

Victoriy пишет:

Похоже я открыла ящик Пандоры, научив А.Ю. пользоваться PDB smile.
Уважаемый Александр Юрьевич, давайте вместе проанализируем Ваш материал по кодированию различных видов спиралей на основе экспериментально показанных спиральных участков в белках 1TAG; 3SDH; 1GPB; 1PZ4; 1OBO; 1GS6; 1H1N; 1LRV и АПФ от Дипроспана. Структура последнего энзима мне лично не безразлично, т.к. его активность в сыворотке крови пациентов с лакунарными инсультами я определяла в этом году в одной из текущих НИР.
Предлагаю в скайпе голосом, а потом Вы выложите свой материал на форуме.

На форум интересно текст выложить, а не голос smile Давайте сначала разберёмся с самоповеркой пикотехнологии: http://nanoworld.org.ru/topic/1533/

Согласитесь, что таких случайностей просто не бывает smile

Кстати, эта тема имеет продолжение: http://nanoworld.org.ru/topic/1535/

Итак, вопрос для богини пикотехнологии, Виктории Соколик:

"Вы согласны, что структуры альфа-спирали, 310-спирали, фрагмента лизоцима из этой темы: http://nanoworld.org.ru/topic/1533/ однозначно подтверждают:

1. Кодирование прямой альфа-спирали кодами -1111111111111111111111-
2. Кодирование прямой 310-спирали кодами -444444444444-
3. Программирование цикла из 22 аминокислотных остатков лизоцима" ?

Если есть возражения, то жду Ваших аргументов. Пока мы не придём к консенсусу по данному вопросу, более сложные вопросы, как то нюансы статистики, я обсуждать не готов.



Формы, механизмы, энергия наномира. Сообщение 83 442

Victoriy пишет:

А.Ю., ну и чем я заслужила такую напраслину:
Виктория спорит с азами теории вероятностей;

Кушелев: Почему напраслина?

https://img-fotki.yandex.ru/get/176331/158289418.3a9/0_16e469_468e8c12_L.png

Вы же утверждаете, что альфа-спираль может кодироваться и "1" и "4", но в таком случае последовательность кодов 1111111111111111111111 не имеет смысла, случайна, по той причине, что замена "1" на "4" не должно испортить прямую альфа-спираль. Но вероятность случайного возникновения последовательности из 22 единиц такая же, как монетка 44 раза упадёт на "орла". Если для Вас это - "пустой звук", значит Вы не понимаете азов теории вероятностей. Если не согласны, кидайте монетку, пока не упадёт 44 раза подряд на "орла" smile


Skype, 2016-12-25:

[22:01:39] Andrei: так никому ничего не доказать
[22:02:23] Кушелев Александр Юрьевич: Есть люди, которым не только не докажешь, но даже не покажешь wink
[22:02:28] Andrei: даже Виктория не убеждена не говоря уже о других
[22:02:35] Andrei: неубедительно
[22:05:35] Andrei: никто в такие рассказики не уверует
[22:06:03] Кушелев Александр Юрьевич: Слышали анекдот про блондинку? Её спросили: "Какова вероятность встретить на улице динозавра?"
-"Фифти-фифти". Либо встречу, либо нет smile



Victoriy пишет:

У Виктории размеры электронов/граней отличаются на порядок больше, т.е. ошибочно.

Кушелев: Сначала я определил радиусы кольцевых электронов из рефрактометрических радиусов ионов кислорода, хлора и фтора (Работа Гольдшмидта 1923г). Для ионов кислорода, хлора и фтора отличие радиусов электронов не превышало 1%. Позднее радиусы электронов удалось уточнить масштабированием белковых молекул. Ведь макромолекулы белка могут иметь гигантские размеры в масштабах микромира. Я подобрал размер кольцевого электрона таким образом, чтобы размеры белковых молекул, определённых экспериментально совпали с кольцегранными моделями в программе PiMol и HyperChem.
Совпадение размеров макромолекул получилось при диаметре кольца-электрона 1.7А.



Эволюция фрактального самопрограммирования

В процессе эволюции добелкового мира возник белковый мир, основой которого стал генетический код. В процессе эволюции появился композиционный генетический код, управляющий рибосомой эукариот.

Структуры белков чем-то напоминают ячейки Бенара, т.е. однотипные элементы.

В процессе эволюции фрактального самопрограммирования возникают маловероятные, но функциональные структуры.

https://img-fotki.yandex.ru/get/195771/158289418.3a9/0_16e45e_5079e0c_orig.png
Протяженные прямые 310-спирали (показаны красной полосой),

https://img-fotki.yandex.ru/get/176331/158289418.3a9/0_16e469_468e8c12_orig.png
Протяжённые альфа-спирали (показаны широкой красной полосой),

http://nanoworld88.narod.ru/data/288_files/0_85d09_8d7f6a3d_orig.gif
менее протяженные пи-спирали (показаны синим),

http://img-fotki.yandex.ru/get/6301/126580004.53/0_bcc39_20b9a5c1_orig.gif
и бета-спирали (показаны зеленым).

https://img-fotki.yandex.ru/get/3505/158289418.3a9/0_16e46d_b82fdb29_orig.png


http://nanoworld88.narod.ru/data/210_files/0_480da_7089f224_orig.gif
А так же их периодические комбинации.

Фрактальная архитектура белков имеет ярко выраженную аналогию с фрактальной архитектурой мегалитов.

http://nanoworld88.narod.ru/data/236_files/0_5123a_2284861d_orig.png
Подробнее: http://nanoworld88.narod.ru/data/236.htm

В структуре крупных белков прослеживается тот же фрактальный принцип.

https://img-fotki.yandex.ru/get/197102/158289418.3a8/0_16e35d_1aff86e7_XL.gif
Оригинал: https://img-fotki.yandex.ru/get/197102/ … 7_orig.gif
В середине структуры мы видим крупные спиральные блоки, а к обоим концам всё более мелкие.

http://nanoworld88.narod.ru/data/210_files/0_480e8_46d28a30_orig.gifhttp://nanoworld88.narod.ru/data/210_files/0_480df_c1431c83_orig.gif
Подробнее: http://nanoworld88.narod.ru/data/210.htm
Отдельной темой идут архитектурные и музыкальные перевертыши.

http://nanoworld88.narod.ru/data/025_files/1.gif
Шедеврами фрактальной белковой архитектуры являются многофункциональные квазиперевертыши, которые оптимально выполняют архитектурные, музыкальные и другие функции.

Именно невероятные комбинации кодов позволяют получить рекордные параметры. Вероятность случайного повторения 22 кодов прямой альфа-спирали не превышает 5.8*10^-14
Ничтожно мала вероятность случайного замыкания фрагмента лизоцима, состоящего из 22 аминокислотных остатков. Ничтожна вероятность образования 310-спирали, кодируемой 17-ю одинаковыми кодами. Ничтожна вероятность возникновения периодической структуры с циклическим повторением комбинации композиционных кодов.


А.Ю., Вы же знаете мою точку зрения по кодированию специфики спиралей: ОНА НЕ КОДИРУЕТСЯ. Вопрос не случайности в данном случае вообще голословен без статистики. Это мне напоминает перл из новогоднего старого фильма: "Есть ли жизнь на Марсе, нет ли жизни на Марсе...."
Не бойтесь, в статистике нет нюансов, там все прозрачно и математически. Я помогу в скайпе.


Kushelev пишет:

Уважаемая Виктория!
Как Вы относитесь к самоповерке пикотехнологии?

Victoriy Перестаньте увиливать от поверки с экспериментом smile.


Victoriy пишет:

А.Ю., Вы же знаете мою точку зрения по кодированию специфики спиралей: ОНА НЕ КОДИРУЕТСЯ.

Кушелев: Тогда расскажите, как Вы получаете PDB-файл 310-спирали (по моей таблице последовательность кодов 44444444444444), альфа-спирали (по моей таблице 11111111111111), пи-спирали (33333333333333333), бета-спирали (2222222222222) ?

Какие из типов вторичных структур может строить Ваша программа?

1. Альфа-спираль
2. Бета-спираль
3. Пи-спираль
4. 310-спираль

Поставьте галочки, а то я до сих пор понять не могу...


Сходство и различие генетического кода с языком

В генетическом коде любая комбинация букв ACGT является осмысленной и соответствует конкретной структуре белковой молекулы. Те же последовательности могут использоваться для кодирования сигналов и других семантических объектов.

В языке осмысленные комбинации букв (слова) представляют малое подмножество всех комбинаций.

Например, случайное следование трёх одинаковых букв в слове "длинношеее" казалось бы имеет малую вероятность. (1/32)^3=0,00003 - три стотысячных. Это соизмеримо с величиной, обратной количеству осмысленных слов языка (0.00001). Однако есть слова, например, "обороноспособность", состоящие из 18 букв. Случайная комбинация имеет вероятность 8*10^-28. Таким образом множество осмысленных слов (10^5) меньше множества всех комбинаций 18-буквенных слов (10^28) на 28-5=23 порядка. Напомню, что число Авогадро = 6*10^23, т.е. величина того же порядка. Другими словами, размер множества осмысленных слов языка подобен атому в моле (множестве случайных комбинаций букв).

Я подвожу читателей к осмыслению того факта, что в процессе эволюции на каждом следующем её уровне достигаются всё менее вероятные комбинации элементов для достижения всё более экзотических параметров системы.

Степень экзотики - мера волшебства (С) А.Кушелев


https://img-fotki.yandex.ru/get/173476/158289418.3a9/0_16e47b_387b69ea_orig.jpg



Формы, механизмы, энергия наномира. Сообщение 83 457

Skype, 2016-12-26:

[8:48:39] Andrei: Один профессор, которому я написал, ответил что:
[8:48:46] Andrei: "Unfortunately, my specific expertise is not in protein folding but in docking."
[8:49:36] Andrei: Может ли быть от программы "Пикотехнология" польза для доккинга?
[8:54:38] Andrei: вот например что я нашел про доккинг
[8:54:40] Andrei: http://www.dockingserver.com/web

[8:55:05] Andrei: можно ли такое сделать на базе этой программы и как?
[9:03:46] Andrei: там и бесплатно можно расчет получить для сравнения
[10:38:48] Кушелев Александр Юрьевич: Польза для доккинга конечно. Ведь правильной формы молекулы легко состыкуются smile
[10:39:46] Andrei: ну так этим можно проверить программу?
[10:39:59] Кушелев Александр Юрьевич: Конечно.
[10:40:06] Andrei: как именно
[10:40:21] Кушелев Александр Юрьевич: Если автоматически состыкуются белки, значит правильно сделаны
[10:40:34] Andrei: доккинг это состыковка белков?
[10:42:58] Andrei: ага
[10:43:03] Andrei: https://ru.wikipedia.org/wiki/%D0%9C%D0 … 0%BD%D0%B3



Формы, механизмы, энергия наномира. Сообщение 83 484

Самоповерка пикотехнологии

Денис пишет:

Если вероятность одного из 4 кодов одинакова, то вероятность комбинации 1111111111111111111111 такая же как 1212121212121212121212, 2212331223213113113233, 3444134142143324442111 или любой другой комбинации с одинаковым количеством вариантов.

Кушелев: Совершенно верно! И одна из 2^44 комбинаций будет 1111111111111111111111

Но если Вы внимательно посмотрите на композиционные коды белков, то комбинация 1111111111111111111111 встретилась уже дважды, хотя я проверил всего несколько десятков белков. А это значит, что среди 2^44 белков попадётся не менее(!) 2^41 структур с последовательностью 1111111111111111111111

Как видите реальная частота выше случайной в 2^41 раз smile




Программа Пикотех помогает биологам делать научные открытия!

Научные работы Виктории Соколик

http://subscribe.ru/archive/science.news.nanoworldnews/201004/19221806.html

Уважаемые читатели! Предлагаю Вашему вниманию научную статью Виктории Соколик, содержащую очень важное научное открытие, которое помогла сделать программа "Пикотех". Речь идёт о механизме возникновения обширной группы наследственных болезней, с которыми можно справиться благодаря пикотехнологии. В связи с важностью научного открытия привожу статью полностью.

Украiнський вiсник психоневрологii – 2009. – Т.46, вип.8.- С. 116—121.





















Научные работы Виктории Соколик

Обсуждение на форуме лаборатории Наномир.


Виктория Соколик в лаборатории Наномир

http://img-fotki.yandex.ru/get/4212/nanoworld.1a6/0_3c3f7_b86aa3c5_L.jpg

16 апреля 2010 года Виктория Соколик приехала в г. Дмитров

http://img-fotki.yandex.ru/get/4208/nanoworld.1a6/0_3c3f9_b9176585_L.jpg

Ещё на железнодорожном вокзале началась научная дискуссия на тему "Пикотехнологические модели ДНК"...

http://img-fotki.yandex.ru/get/4213/nanoworld.1a6/0_3c3fa_25ce204a_L.jpg

Богиня биологии перевернула пакет, и из него, как из Рога изобилия посыпались пикотехнологические модели белковых молекул и молекул РНК/ДНК...

http://img-fotki.yandex.ru/get/11/nanoworld.1a6/0_3c3fb_e4c73073_L.jpg

Ярослав Старухин: "Разрешите заснять Ваши пикотехнологические модели на видео!"

http://img-fotki.yandex.ru/get/4210/nanoworld.1a6/0_3c3fc_5d5ac345_L.jpg

Александр Кушелев: "Пока Ярослав записывает Ваши замечательные модели на видео, позвольте полюбопытствовать, как Вам удалось сделать модели такими яркими, цветными?"

http://img-fotki.yandex.ru/get/7/nanoworld.1a6/0_3c3fd_960afece_L.jpg

Виктория Соколик: "Вообще-то это - Ноу-Хау, но Вам я по секрету скажу. Я покрасила кольца лаком для ногтей разных цветов"

http://img-fotki.yandex.ru/get/2914/nanoworld.1a6/0_3c3fe_28028c70_L.jpg

Кушелев: Я бы до этого гениального решения ни за что бы не додумался!

http://img-fotki.yandex.ru/get/4308/nanoworld.1a6/0_3c3ff_1684770c_orig.jpg

В качестве лирического отступления предлагаю посмотреть 45-секундную ТВ-передачу из лаборатории Наномир, где речь идёт о пикотехнологической модели молекулы тимогена.

Это - материал из видеоархива лаборатории Наномир. Первая часть видеоархива. Там Вы сможете посмотреть самые первые видеозаписи из лаборатории Наномир, сделанные в 1992-1993 годах.

http://img-fotki.yandex.ru/get/4312/nanoworld.1a6/0_3c401_1726603d_L.jpg

Кушелев: Ого! Они у Вас ещё и поворачиваются на шарнирах?!

http://img-fotki.yandex.ru/get/4311/nanoworld.1a6/0_3c402_6508b624_L.jpg

Виктория: А Вы как думали? Эта модель показывает переход ротамеров, кодируемых композиционным генетическим кодом. В первом приближении наши модели совпадают, но есть, как видите, и отличия. Например, радикал аминокислот в моей модели соединён с другой гранью атома углерода.

http://img-fotki.yandex.ru/get/4311/nanoworld.1a6/0_3c403_1f5cf538_L.jpg

Виктория: Эта модель помогла мне сделать научное открытие, о котором я рассказываю в научной статье. Эту статью Вы можете опубликовать на форуме вместе со ссылкой на публикацию в академическом журнале.

http://img-fotki.yandex.ru/get/4214/nanoworld.1a7/0_3c404_2e30e2a2_L.jpg

Кушелев: Я правильно понял, что серебристым цветом в этой модели показаны CH3-группы, т.е. радикалы аланина?

http://img-fotki.yandex.ru/get/4209/nanoworld.1a7/0_3c405_549c16ce_L.jpg

Виктория: Совершенно верно! А эта модель показывает переход ротамеров. Следующий остаток в этой модели может поворачиваться вокруг оси и фиксироваться в положениях 0, +120 и -120 градусов.

http://img-fotki.yandex.ru/get/4308/nanoworld.1a7/0_3c406_19d12edc_L.jpg

Вот я поворачиваю следующий остаток относительно предыдущего и получается другой ротамер, который, естественно, кодируется другим триплетом ДНК.

http://img-fotki.yandex.ru/get/4211/nanoworld.1a7/0_3c407_ce4987d6_L.jpg

Кушелев: Вижу. Это третий вариант композиции, т.е. третий ротамер по Вашей терминологии.


Виктория: А это - пикотехнологическая модель амфипатического участка спирали белка. Каждый четвёртый радикал несёт электрический заряд, с помощью которого происходит слипание амфипатических участков спиралей...

http://img-fotki.yandex.ru/get/4209/nanoworld.1a7/0_3c409_d7814f31_L.jpg

Кушелев: Амфи... что?

Виктория: Амфипатического участка.

Кушелев: Надо запомнить ... smile

http://img-fotki.yandex.ru/get/4211/nanoworld.1a7/0_3c40b_4297fd0a_L.jpg

А модель впечатляет. Надо будет почитать Вашу научную статью...

http://img-fotki.yandex.ru/get/4311/nanoworld.1a7/0_3c40c_f6e4a585_L.jpg

Ярослав: А что за научное открытие позволила сделать эта пикотехнологическая модель?

http://img-fotki.yandex.ru/get/9/nanoworld.1a7/0_3c40d_419a2318_L.jpg

Виктория: Мне удалось найти правильное расположение амфипатических участков, которые раньше были определены неправильно.

http://img-fotki.yandex.ru/get/4308/nanoworld.1a7/0_3c40e_7dd4a978_L.jpg

Сейчас я покажу Вам статью и схему этого белка на компьютере...

http://img-fotki.yandex.ru/get/2914/nanoworld.1a7/0_3c40f_84a27043_L.jpg

Кушелев: Отлично. А я пока запишу на видео, как работает Ваша модель ротамеров...

http://img-fotki.yandex.ru/get/55/nanoworld.1a7/0_3c410_93e8f48e_L.jpg

Виктория: А в правой руке у Вас - модель иминокислоты пролина.

http://img-fotki.yandex.ru/get/8/nanoworld.1a7/0_3c411_99620a09_L.jpg

Кушелев: Да, модели шикарные. А NH2-группа в пролине у Вас расположена иначе, чем в аминокислотах?

http://img-fotki.yandex.ru/get/8/nanoworld.1a7/0_3c412_3a49edcb_L.jpg

Виктория: Да.

http://img-fotki.yandex.ru/get/4209/nanoworld.1a7/0_3c413_56198245_L.jpg

Кушелев: У меня тоже сначала была модель, где группа NH2 пролина была расположена иначе, чем в аминокислотах, но позднее я пришёл к выводу, что она находится там же, только вместо жёсткой связи соединена с группой COOH гибкой связью, что позволяет в этом месте организовать сустав между участками альфа-спиралей или других вторичных структур.

http://img-fotki.yandex.ru/get/4311/nanoworld.1a7/0_3c414_64566faf_L.jpg

Поэтому пролин ставится в растущую белковую цепь так же, как и аминокислоты.

http://img-fotki.yandex.ru/get/4310/nanoworld.1a7/0_3c422_c1004398_L.jpg

Кушелев: Все отличия между нашими пикотехнологическими моделями можно обсудить позже на форуме. Там же мы можем разобраться, какая из моделей ближе к истине. Мне без разницы, моя или Ваша. Главное - выяснить, какая конкретно.

http://img-fotki.yandex.ru/get/4309/nanoworld.1a7/0_3c4af_5573ff62_L.jpg

Кушелев: В чём отличие между нашими моделями мне понятно. Дальше эти отличия можно обсуждать на форуме, а теперь хотелось бы посмотреть Ваши научные статьи на компьютере...

http://img-fotki.yandex.ru/get/4307/nanoworld.1a7/0_3c4b0_406a10e5_L.jpg

Самые интересные фрагменты научной дискуссии удалось записать на видео благодаря Анатолию Шестопалову. Благодарим Вас, Анатолий!

http://img-fotki.yandex.ru/get/2914/nanoworld.1a7/0_3c4b1_9cf8e5a2_L.jpg

Люба тоже принимала активное участие в дискуссии и в конце-концов разобрала модель ротамеров, но смогла потом снова собрать. smile

http://img-fotki.yandex.ru/get/4208/nanoworld.1a7/0_3c4b2_d2bcafc4_L.jpg

Кушелев: Модель АСС-конца транспортной РНК помогает понять, под каким углом расположены следующий и предыдущий аминокислотные остатки в момент выдавливания группы OH предыдущего остатка группой NH3 следующего остатка.

http://img-fotki.yandex.ru/get/4310/nanoworld.1a7/0_3c4b3_56334ac6_L.jpg

Виктория: А давайте сделаем модель транспортной РНК целиком.

Кушелев: Так там 90 ступеней ДНК...

Виктория: Ну и что? Не так уж много. Можно на компьютере попробовать.

Кушелев: Лучше изготовить модель из колец. На компьютере будет проще потом сделать.

http://img-fotki.yandex.ru/get/4212/nanoworld.1a7/0_3c4b5_c293fec2_L.jpg

Вероятно, установка следующего аминокислотного остатка осуществляется под таким углом. Иначе OH-группа не сможет выйти в раствор...

http://img-fotki.yandex.ru/get/2914/nanoworld.1a7/0_3c4c6_d76277d5_L.jpg

Виктория: Вращение ротамеров у нас происходит вокруг этой оси.

http://img-fotki.yandex.ru/get/55/nanoworld.1a7/0_3c4d0_3b7aaaa_L.jpg

Кушелев: А вращение аминокислоты с t-RNA может происходить вокруг другой оси, которая наклонена, например, под тетраэдрическим углом. Кстати, это позволяет уменьшить число ошибок в работе рибосомы...

http://img-fotki.yandex.ru/get/4311/nanoworld.1a7/0_3c4d5_13b8329d_L.jpg

Именно модельный эксперимент позволяет понять, как же работает рибосома...

http://img-fotki.yandex.ru/get/4307/nanoworld.1a7/0_3c4d6_c472a1e5_L.jpg

Справа мы видим фрагмент транспортной РНК (АСС-конец с закреплённой на нём аминокислотой). Группа NH2 должна выдавливать группу OH из предыдущего аминокислотного остатка.

Слева мы видим ротамерную модель Виктории Соколик, которая помогает понять, под каким углом должна двигаться группа NH2, чтобы группа OH смогла выйти в раствор, не разрушив предыдущий аминокислотный остаток.

Различий между пикотехнологическими моделями Виктории Соколик и моими мало. Они заключаются в расположении радикала. Виктория расположила радикал так же, как и Дмитрий Кожевников.

http://img-fotki.yandex.ru/get/4214/nanoworld.1a7/0_3c4d7_fb51f6fe_L.jpg

Виктория Соколик: Значит, в Вашей модели аминокислота удерживается АСС-концом т-РНК с помощью 4 нехимических связей?

Кушелев: Да, четырьмя вандерваальсовыми связями.

http://img-fotki.yandex.ru/get/4312/nanoworld.1a7/0_3c4d8_9a97680b_L.jpg

И этого достаточно, чтобы удержать аминокислоту?

http://img-fotki.yandex.ru/get/4314/nanoworld.1a7/0_3c4d9_2d6239d8_L.jpg

Кушелев: А почему бы и нет?

http://img-fotki.yandex.ru/get/4310/nanoworld.1a7/0_3c4da_900105fd_L.jpg

Виктория Соколик: Видите, какой получился симметричный граф композиций аминокислот?

http://img-fotki.yandex.ru/get/4307/nanoworld.1a7/0_3c4db_a228a60_L.jpg

Кушелев: Это, конечно, здОрово, но нужно разобраться, симметричен он только в теории или в реальности? Может быть в реальности граф композиций не так уж и симметричен? smile

http://img-fotki.yandex.ru/get/9/nanoworld.1a7/0_3c4dc_49de7148_L.jpg

Виктория: Такая симметрия соответствует другой таблице композиционного генетического кода.

Кушелев: А на сколько она отличается от моей?

Виктория: 4 варианта композиции из 64 другие.

Кушелев: -Это мелочи.

Виктория: В науке мелочей не бывает.

Кушелев: Да я шучу. Кстати, даже если все варианты были бы неправильными, то по сравнению с самим фактом существования композиционного генетического кода - это мелочь. Но таблицу, конечно же нужно проверить. Может быть там содержатся ошибки, причём даже такие, о которых мы ещё не знаем...

http://img-fotki.yandex.ru/get/55/nanoworld.1a7/0_3c4dd_2c0e47aa_L.jpg

Виктория: А вот и амфипатические участки, которые удалось открыть с помощью программы "Пикотех". Они оказались совсем не там, где считалось ранее.

http://img-fotki.yandex.ru/get/4209/nanoworld.1a7/0_3c4de_691a1808_L.jpg

Кушелев: Я уже давно заметил, что рентгеноструктурный анализ не позволяет выявлять некоторые структурные особенности белков. Программа "Пикотех" позволяет многое уточнить в базах данных по структурам белка.

http://img-fotki.yandex.ru/get/11/nanoworld.1a7/0_3c4df_a3ba76a5_L.jpg

А тематика конференции в Сыктывкаре очень даже связана с эликсиром "вечной молодости"... smile

http://img-fotki.yandex.ru/get/55/nanoworld.1a7/0_3c4e0_68c0d897_L.jpg

Виктория убеждена, что старость не запрограммирована. Тем не менее она уже помогла мне уточнитьметодику создания эликсира "вечной молодости".

http://img-fotki.yandex.ru/get/8/nanoworld.1a7/0_3c4e2_32e8841_L.jpg

Виктория оставила электронные копии своих научных работ, в т.ч. связанных с пикотехнологией.

http://img-fotki.yandex.ru/get/4210/nanoworld.1a7/0_3c4e3_71b279f_L.jpg

Сегодня я постараюсь опубликовать эти работы на форуме лаборатории Наномир.

http://img-fotki.yandex.ru/get/55/nanoworld.1a7/0_3c4e5_7b23849c_L.jpg

Люба: Уважаемые участники конференции, не пора ли перекусить?

http://img-fotki.yandex.ru/get/55/nanoworld.1a7/0_3c4e7_21d11d80_L.jpg

Можно начать здесь, а продолжить на кухне...

http://img-fotki.yandex.ru/get/4310/nanoworld.1a7/0_3c4e6_f6b38730_L.jpg

Кушелев: В чём отличие между нашими таблицами композиционного генетического кода мне понятно. Обсудить это можно на форуме, а сейчас предлагаю сделать антракт и переместиться на кухню smile

Научные работы Виктории Соколик

Обсуждение

Доклад Виктории Соколик на III Международной конференции «Актуальные проблемы биологии, нанотехнологий и медицины».

Тезисы докладов (1-4 октября 2009 г.), Ростов-на-Дону. – С. 54.






















Научные работы Виктории Соколик

Материал с форума лаборатории Наномир.

http://img-fotki.yandex.ru/get/4310/nanoworld.1a9/0_3c59c_5ae98cca_L.jpg

Кушелев: Обратите внимание на структуру с чередованием кодов альфа-спирали и 3/10-спирали. Могла бы быть такая последовательность кодов, если в таблице не было бы разницы между кодом альфа-спирали и 3/10-спирали?

Виктория: А почему нет?

Кушелев: Трудно поверить, что "гребёнка" 141414141414, где 1 - код альфа-спирали, а 4 - код 3/10-спирали, возникла случайно.

Давайте найдём такие структуры, которые покажут, какая из таблиц правильная.

Начать можно с того, что моя таблица была построена по конкретным экспериментальным данным.

Давайте посмотрим, какие структуры моделей для этих белков получатся при замене моей таблицы на Вашу?

Если структуры изменятся несущественно, значит между нашими таблицами нет принципиальной разницы. Если же изменения будут принципиальными, значит разница есть и с помощью экспериментальных данных можно будет сделать выбор между таблицами.

http://img-fotki.yandex.ru/get/4213/nanoworld.1a9/0_3c59d_51de344b_L.jpg

Обсуждение.


Пикотехнологические модели Виктории Соколик.

Подробнее.


На дмитровском валу...

http://img-fotki.yandex.ru/get/4314/nanoworld.1aa/0_3c5de_73277572_L.jpg

Татьяна Кушелева и Виктория Соколик заинтересовались мегалитическим объектом дмитровский вал.

http://img-fotki.yandex.ru/get/7/nanoworld.1aa/0_3c5df_158e5396_L.jpg

Татьяна Кушелева и Александр Кушелев на мегалитическом объекте, дмитровском валу.

16 апреля 2010 года.

Фото Виктории Соколик.

http://img-fotki.yandex.ru/get/6/nanoworld.1aa/0_3c5e0_bf6980e_L.jpg

Историческая встреча в г.Дмитрове.
Александр Кушелев, Виктория Соколик.

16 апреля 2010 года.

Фото Татьяны Кушелевой.

http://img-fotki.yandex.ru/get/55/nanoworld.1aa/0_3c5e4_409af493_L.jpg

Знакомьтесь, богиня биологии, Виктория Соколик. Дмитровский вал, 16 апреля, 2010г.

http://img-fotki.yandex.ru/get/4210/nanoworld.1aa/0_3c5e5_35518b67_L.jpg

Виктория Соколик и Татьяна Кушелева спускаются с дмитровского вала.

http://img-fotki.yandex.ru/get/4313/nanoworld.1aa/0_3c5e6_91127c7a_L.jpg

http://img-fotki.yandex.ru/get/4311/nanoworld.1aa/0_3c5e7_612bf16e_L.jpg

Виктория сказала, что г.Дмитров ей понравился.


Научные работы Виктории Соколик


Кушелев на CASP - "неудобный" конкурс, "неудобный" конкурсант

http://subscribe.ru/archive/science.news.nanoworldnews/201402/16194748.html

Организаторы CASP 2014 рассекретили списки участников!

Их оказалось в 10 раз меньше заявленного количества...







Пример белка из CASP8. Целевая структура показана цветом в ленточной модели. Показано наложение 354 предсказанных структур (серый цвет, визуализация остова).


CASP (англ.Critical Assessment of protein Structure Prediction, критическая оценка предсказания белковых структур) — масштабный эксперимент попредсказанию белковых структур. Проходит с 1994 года с периодичностью каждые два года.[1] CASP объективно тестирует методы предсказания белковых структур и предоставляет независимую оценку структурного моделирования. Основная цель CASP — помощь в улучшении методов определения трехмерной структуры белков из их аминокислотных последовательностей. Более 100 исследовательских групп принимают участие в проекте на постоянной основе. CASP считается всемирным соревнованием в науке структурного моделирования. Википедия






CASP 2012

http://nanoworld88.narod.ru/data/279.htm

diprospan: Почему один и тот же пост в среду 11 янв 2012 в 12:02 выглядит в оригинале eng и после перевода rus по разному ?

Kushelev: Это ещё мелочи. Почему утром в теме было 4 страницы, а вечером осталась одна? Похоже, что в конкурсе CASP нас будут ждать если не тройные стандарты, то двойные стандарты точно ...

Напомню, что в конкурсе CASP3 перед розыгрышем призов из списка участников неожиданно исчезло 5 лабораторий, в т.ч. и лаборатория Наномир: http://nanoworld88.narod.ru/forum/casp/cafasp.htm

Руководитель конкурса сообщил, что данные, накопленные на сервере CAFASP за полтора месяца, были удалены "по техническим причинам".

Вероятно, по тем же причинам в начале февраля исчезли все мои сообщения на форуме FORCASP в теме, которую я открыл 11 декабря 2011 года. Но, рукописи не горят, поэтому желающие могут прочесть копию уничтоженной темы: http://nanoworld88.narod.ru/forum/casp/index.htm



2012.03.15 19:23:02

http://nanoworld.org.ru/topic/5/page/126/

http://nanoworld.org.ru/post/11952/#p11952

Victoria пишет:Kushelev пишет:

Кушелев: Уважаемая Виктория!
А может быть Вы съездите на этот митинг CASP, где соберутся участники конкурса? Это же не через океан лететь... smile
Там можно познакомиться с заказчиками белковых структур лично ...

А что, кто-то приглашал? smile
Если серьёзно, то зарубежные поездки за свой счёт мне не по карману.
В остальном, я не против. А Вы почему не рассматриваете возможность собственной поездки?

Кушелев: Если организаторы CASP огласят список всех участников на митинге, а мы с Вами как бы участвуем в конкурсе, то получается, что нас как бы приглашают на митинг. Иначе как мы узнаем список участников?

Что касается "за свой счёт", то я имел в виду, что соинвесторы лаборатории Наномир заинтересованы вывести товар на международный рынок. PDB-файлы - товар наукоёмкий и дорогой. Поэтому на Вашу поездку деньги найдутся. Если моё присутствие на митинге CASP целесообразно, то я тоже могу поехать. Это - Европа, можно добраться поездом. Думаю, что и Ярославу Петровичу будет полезно присутствовать на этом митинге.

А то, что Вы не против, это очень хорошо. От Вашего присутствия на этом митинге, вероятно, зависит успех нашего выхода на международный рынок PDB-файлов. А по-большому счёту речь идёт о создании нового рынка - рынка пикотехнологий. Мы со дня на день ждём на форуме первого заказчика PDB-файлов, который уже зарегистрирован на форуме лаборатории Наномир.




Подробнее см. в 297-ом выпуске рассылки "Новости лаборатории Наномир"

Виктория Соколик вынуждена портить модель, подстраивая реальность под устаревшие официальные взгляды...

О пригодности CASP для пикотехнологов можно прочесть в 284-ом выпуске рассылки "Новости лаборатории Наномир"

Пикотехнологические модели на конкурс CASP10 можно посмотреть в 310-ом выпуске рассылки "Новости лаборатории Наномир"




Попытки связи с организаторами конкурса CASP похожи на общение с радиоточкой...

Кстати, никаких данных, по которым можно было бы понять, что за группа Victoria принимает участие в конкурсе CASP, я не обнаружил. Это значит, что на конкурсе CASP скрыты данные, указанные при регистрации группы, например, сайт группы.

Обсуждение




Научное открытие на конкурсе CASP прошло незамеченным...

Ни организаторы CASP, ни его участники, ни потенциальные заказчики белковых структур не заметили научное открытие, сделанное мною на конкурсе CASP в 2012 году. Ни у кого даже вопросов не возникло по структуре интерлейкина-34...

Пикотехнологическая модель интерлейкина-34





http://subscribe.ru/archive/science.news.nanoworldnews/201402/16194748.html

Кушелев: Глазам своим не верю! Неужто на сайте можно найти данные из лаборатории Наномир?!

Наша группа выступает под номером 469, но на самом деле в конкурсе принимают участие 44 участника smile

Виктория Соколик: Я Вам больше скажу, если Вы кликните на оранжевый график например R0001, то у Вас на экране появится окошко с его большим изображением и активными окнами в заголовке: http://predictioncenter.org/casprol/gdtplot.cgi?target=R0001&group=5&models=first Смело нажимайте Tables и получите данные по первой задаче для всех участников CASP, а заодно и искомый список участников. В других опциях заголовка можно ознакомиться с оценочными данными и критериями для представленных моделей всех участников. Удачи в анализе материала. Надеюсь, что данная информация положит конец Вашим эскападам в адрес организаторов этого конкурса. Все результаты на виду, нужно было только разобраться вместо того, чтобы сыпать беспочвенными обвинениями и подозрениями.

Кушелев: Я с самого начала считал организаторов порядочными людьми, пока они не исключили из списка участников 5 лабораторий, включая лабораторию Наномир


А в 2012-ом году списки участников были засекречены вообще. И всех, кто интересовался этими списками на форуме ForCASP забанили, а дискуссию, в которой принимало участие более 10 человек из разных стран, уничтожили. Копию этой дискуссии я скоро снова выложу на сервер. Начало дискуссии на форуме ForCASP опубликовано в 300-ом выпуске рассылки "Новости лаборатории Наномир"

Но времена меняются, и теперь списки участников CASP 2012 года стали доступны. Это радует. Давайте посмотрим данные группы Victoria.


В конкурсе CASP3 лаборатория Наномир числилась среди участников на последнем, 33-ем месте. В конкурсе CASP10 (2012г.) наша группа Victoria числится тоже на последнем, 44-ом месте. Как видим в конкурсе реально участвуют 44 группы.


Кушелев: В конкурсе CASP по прежнему в качестве входных данных предлагается аминокислотная последовательность, которая не содержит информации о вторичной структуре белка...


Пространственную модель и PDB-файл конкурсного белка на конкурс CASP не принимают, т.к. официально считается, что расстояния между атомами не могут быть меньше некоторой величины, которая не соответствует реальности.




http://nanoworld.org.ru/topic/223/page/31/

2012.02.15 13:00:19

Уважаемая Виктория!

А что нам пишут организаторы CASP?

Dear member of CASP community,

Silvia Crivelli (LBNL, UC Davis, and a member of this community since 1998) is organizing a collaborative group to participate in CASP10 and possibly in CASP ROLL if time permits. This collaborative experiment will let different groups or individuals work on different components of the protein structure prediction pipeline (like alignment, loop modeling, scoring, etc) thus making it possible to leverage expertise at a large scale. The initial goal is to focus on ab initio targets. Certain groups may want to participate in the collaborative effort for all the ab initio targets while others may want to do just a few of them.

If you would like to learn more about this effort please visit wefold.wordpress.com or contact Silvia directly at SNCrivelli@lbl.gov.



Пикотехнология белков, ДНК, РНК

Victoria пишет:

Они пишут, что
Silvia Crivelli (LBNL, UC Davis, член CASP с 1998) организует совместную группу, чтобы участвовать в CASP10 и возможно в CASP ROLL, если успеет. Этот совместный эксперимент позволит различным группам или индивидуумам работать над различными компонентами предсказания структуры белка (такими как выравнивание, моделирование петли, выигрыш, и т.д.) таким образом позволяя усилить экспертизу в большем масштабе. Начальная цель состоит в том, чтобы сосредоточиться на задачах. Определенные группы могут участвовать в совместном решении всех задач с самого начала, в то время как другие могут сделать только несколько из них.

Если Вы хотели бы узнать больше об этом намерении, пожалуйста, посетите wefold.wordpress.com или свяжитесь с Сильвией непосредственно в SNCrivelli@lbl.gov.

Дама стратегически мыслит, сколачивая большую группу с разделением труда для участия в конкурсе CASP ROLL smile.

Victoria пишет:

Дама стратегически мыслит, сколачивая большую группу с разделением труда для участия в конкурсе CASP ROLL smile.

Кушелев: Может быть напишем ей, расскажем о пикотехнологии? Нам любые зацепки могут помочь выйти на рынок белковых структур. Если предложит объединить усилия, то почему бы и нет? Главное условие, чтобы наше участие было задокументировано. Всё остальное - мелочи smile




2012.02.15 20:38:00

Пикотехнология белков, ДНК, РНК

Victoria пишет:

Я не представляю, что мы сможем сделать для Silvia Crivelli и её группы поскольку предполагается, что она разбивает каждую задачу на подзадачи и раздаёт участникам для выполнения громоздким трудо- и время-затратным методом моделирования по гомологии, в котором надо в PDB банке спецпрограммами отыскать подобные заданным куски аминокислотных последовательностей с известной структурой и рассчитывать/надеяться smile на то, что они будут иметь искомую структуру одной из задач CASP.
Мы же с Вами моделируем совсем по другому, буквально сразу получая готовый PDB файл с координатами атомов белка. Ну предложим мы группе Silvia Crivelli уже решенные нами модели, которые загружены на сайте конкурса CASP от имени нашей группы, и ЧТО?
Если бы они в рамках конформационного анализа хоть молекулярную динамику запускали, то можно было бы проверить на наших уже готовых файлах PDB, не сбивается ли пептид в кучу в гидрофобном или гидрофильном микроокружении, может он имеет возможность как-нибудь ещё удачнее сфолдировать свою конформацию из синтезированного структурного шаблона, который мы собственно и моделируем.
Но судя по тексту Silvia Crivelli о таких возможностях в её группе речь не идёт.
А.Ю., я думаю не нужно суетиться и во что бы то не стало стремиться нас засветить. Закончиться конкурс, посмотрим, как наши таланты оценят профессионалы и организуем собственный сервер предсказания/моделирования структур белка. А время и качество наших моделей помогут нас отобрать в естественном отборе лучших из уже существующих как минимум 25 серверов smile.

Кушелев: Какое совпадение! Я тоже так думал в 1998-ом году, особенно, когда организатор конкурса CASP3 прислал мне лично 43 dne-файла всех конкурсных белков. Но когда все данные, которые ставились на сервер в течение полутора месяцев неожиданно исчезли (и так у 5 разных групп из 33), я понял, что "не всё так просто". Поэтому практически не сомневаюсь, что нас с Вами ждёт та же участь и в этом году, если мы не сможем объединить усилия, например, с Silvia Crivelli.

Мы ей однозначно нужны, т.к. можем дать структуры всех белков даже точнее, чем это может РСА и др. экспериментальные методы. Когда она это увидит, то вряд ли откажется от сотрудничества. А её выкинуть с конкурса вряд ли получится. Поэтому у нас есть очень высокие шансы победить вместе с Silvia Crivelli и практически нулевые шансы дойти до финиша без сотрудничества. Нас выкинут, и никто об этом не узнает. Ведь списка участников нет и скорее всего не будет. Поэтому я бы связался с Сильвией и предложил ей выгодное сотрудничество. У нас будет беспроигрышный вариант в том случае, если Сильвия сможет задокументировать наше участие в CASP10. Речь не идёт о призовых местах, хотя и это исключать нельзя. Но пока мы там никто. Нас просто нет по документам. То, что Вам показывают, никто не видит. И если нас выкинут с конкурса, никто об этом не узнает.

В 1998-ом году результаты лаборатории Наномир видели все участники и гости конкурса на протяжении полутора месяцев. И то наше исчезновение из списка участников никто не заметил. А в этом году нас вообще нет в списке. Наши данные, конечно получат и проанализируют, только потенциальные клиенты об этом ничего не узнают. В таком случае у нас нет смысла участвовать в конкурсе вообще. А Сильвия нам может помочь стать полноправными участниками CASP10.



http://nanoworld.org.ru/topic/223/page/32/

2012.02.15 21:20:22

Victoria пишет:

Ну, во-первых никто не видит не только группу Victoria, но и группу Silvia Crivelli, а также все остальные. Открыт только список автоматических серверов. А во-вторых, почему Вы решили, что вместе с ней надёжнее? Вы нашли её группу в списке участников предыдущих конкурсов CASP? Если Вы уверены, что так надежнее, то, как говориться, Вам и карты в руки: лично записывайтесь в группу Silvia Crivelli и отправляйте ей готовые файлы PDB для R0001, R0005, R0006 и т.д. Я ни за эту тётю, ни за другого дядю работать не хочу и не буду.

Уважаемая Виктория! Я Вас прекрасно понимаю. Я же сам так же думал. Но давайте рассуждать. Письмо от Сильвии мы с Вами получили. Похоже, что то же письмо получили и остальные участники CASP10. Верно? Значит о существовании Сильвии знаю все участники CASP10. Мы с Вами можем послать письма всем участникам CASP10? Не можем. Значит Сильвия сумела договориться с организаторами CASP10. А это значит, что с её помощью о нас тоже узнают все участники конкурса.

Конечно, можно пойти и другим путём. Попытаться через организаторов CASP10 разослать аналогичные письма с предложением о сотрудничестве со всеми участниками CASP10. Ну, а если не получится, то остаётся вариант сотрудничества с Сильвией. Иначе у нас шансов (нет, не выиграть конкурс!) просто остаться участниками "ноль целых, ноль десятых". Никто из участников CASP10 просто не узнает, что мы участвовали в этом конкурсе.

Теперь о надёжности. Я не утверждал, что вместе с Сильвией надёжнее. Я писал, что если она сможет задокументировать наше участие в CASP, а она похоже сможет, то наши шансы возрастут немерено. Я имею в виду шансы на то, что нас не выкинут из участников конкурса. А в случае победы группы Сильвии победим и мы. smile Вы же понимаете, что клиенты объединённой группы на самом деле наши клиенты smile Они придут к Сильвии, а без нас она не сможет им дать структуры белков...

Теперь по поводу "Я ни за эту тётю, ни за другого дядю работать не хочу и не буду".

Если будет задокументировано наше участие и то, что мы делаем, то Вам не придётся ни за кого работать. У Вас не смогут отнять то, что Вам принадлежит. Все делают свою работу, а в результате в группу придут клиенты. И без нас этим клиентам структуры белков дать не смогут. Мы же не предлагаем пользоваться нашей программой. Мы всего лишь даём попробовать на вкус результаты работы наших программ, алгоритмов, Ноу-Хау...

Вас же никто не уговаривает рассказывать секреты, которые позволяют Вам определять структуры конкурсных и вообще любых белков smile

Так что с Сильвией договариваться нужно именно Вам, тем более, что Вы знаете английский и сможете понять, что она напишет и написать, чтобы она поняла.

Я бы в первом же письме показал ей и модель интерлейкина-34 (димера), и модель гексамера инсулина, и спираль коллагена. Если она увидит пикотехнологические модели, то скорее всего заинтересуется. А в этом случае начнётся взаимовыгодное сотрудничество. Даже если с CASP она нам не сможет помочь, то через неё мы можем выйти на клиентов, которым нужны структуры белков.

Мы сейчас работаем не на кого-то, а на собственную перспективу. Достаточно найти клиентов на структуры белка, и нам больше не придётся считать копейки smile

Кстати, может быть Сильвии удастся уговорить организаторов раздобыть все нуклеотидные последовательности конкурсных белков...



2012.02.15 21:29:11

http://molbiol.ru/forums/index.php?show … amp;st=200

http://img-fotki.yandex.ru/get/5506/126580004.43/0_b3ecd_708d6ffb_M.gif
http://img-fotki.yandex.ru/get/5506/126 … b_orig.gif




2012.02.15 23:44:22

Victoria пишет:Kushelev пишет:

Письмо от Сильвии мы с Вами получили. Похоже, что то же письмо получили и остальные участники CASP10. Верно? Значит о существовании Сильвии знаю все участники CASP10. Мы с Вами можем послать письма всем участникам CASP10? Не можем. Значит Сильвия сумела договориться с организаторами CASP10. А это значит, что с её помощью о нас тоже узнают все участники конкурса..

Не верно. Письмо от Сильвии получили только Вы. Я полагаю потому, что Вы зарегистрировались на сайте CASP, но не выступили на CASP ROLL. Мне или кому-либо ещё, кто зарегистрировался и там, и там Сильвия писем не шлёт. Она просто не подозревает, что Вы в группе Victoria, вот и пытается собрать группу из волонтёров-одиночек, которые не вступили в игру.

Kushelev пишет:

Конечно, можно пойти и другим путём. Попытаться через организаторов CASP10 разослать аналогичные письма с предложением о сотрудничестве со всеми участниками CASP10. Ну, а если не получится, то остаётся вариант сотрудничества с Сильвией. Иначе у нас шансов (нет, не выиграть конкурс!) просто остаться участниками "ноль целых, ноль десятых". Никто из участников CASP10 просто не узнает, что мы участвовали в этом конкурсе.

Это против правил. Где взяла Сильвия Ваш электронный адрес ей виднее, может случайно набрела на форум Наномир по ключевому слову CASP ROLL. Мне трудно представить, что на правах завсегдатая конкурса она соревнуется по принципу "все средства хороши". Хотя везде только лишь люди...


Kushelev пишет:

Теперь о надёжности. Я не утверждал, что вместе с Сильвией надёжнее. Я писал, что если она сможет задокументировать наше участие в CASP, а она похоже сможет, то наши шансы возрастут немерено. Я имею в виду шансы на то, что нас не выкинут из участников конкурса. А в случае победы группы Сильвии победим и мы. smile Вы же понимаете, что клиенты объединённой группы на самом деле наши клиенты smile Они придут к Сильвии, а без нас она не сможет им дать структуры белков...

По Станиславскому "...НЕ ВЕРЮ"


Kushelev пишет:

Так что с Сильвией договариваться нужно именно Вам, тем более, что Вы знаете английский и сможете понять, что она напишет и написать, чтобы она поняла.
Я бы в первом же письме показал ей и модель интерлейкина-34 (димера), и модель гексамера инсулина, и спираль коллагена. Если она увидит пикотехнологические модели, то скорее всего заинтересуется. А в этом случае начнётся взаимовыгодное сотрудничество. Даже если с CASP она нам не сможет помочь, то через неё мы можем выйти на клиентов, которым нужны структуры белков.
Кстати, может быть Сильвии удастся уговорить организаторов раздобыть все нуклеотидные последовательности конкурсных белков...

А.Ю., постарайтесь на меня не обижаться, но я не буду вступать в переписку с Сильвией ни от своего, ни от Вашего имени. Вы ведь тоже не делаете того, что Вам не интересно.




2012.02.15 23:44:42

Victoria пишет:

Не верно. Письмо от Сильвии получили только Вы. Я полагаю потому, что Вы зарегистрировались на сайте CASP, но не выступили на CASP ROLL. Мне или кому-либо ещё, кто зарегистрировался и там, и там Сильвия писем не шлёт. Она просто не подозревает, что Вы в группе Victoria, вот и пытается собрать группу из волонтёров-одиночек, которые не вступили в игру.

А... Очень интересно. А как она смогла узнать о моём существовании? Почему я не могу узнать о её существовании, о Вашем (через CASP) и о существовании других участников CASP10 ?



2012.02.15 23:51:16

Victoria пишет:

Это против правил. Где взяла Сильвия Ваш электронный адрес ей виднее, может случайно набрела на форум Наномир по ключевому слову CASP ROLL. Мне трудно представить, что на правах завсегдатая конкурса она соревнуется по принципу "все средства хороши". Хотя везде только лишь люди...

Вообще-то я не вижу нарушений правил. Ведь в условиях CASP не сказано, сколько может быть участников в группе и т.д. Так что предложение Сильвии вроде как в рамках правил CASP. Что касается "всех средств", то пока я заметил только предложение по кооперации. Не вижу в этом ничего плохого. Наоборот, если у нас есть наиболее точные координаты атомов, а у Сильвии есть другие возможности, которых нет у нас, то объединение усилий - это шанс на победу по многим параметрам. Ведь CASP - это всего лишь тактика, а выход на клиентов - часть стратегии...



2012.02.15 23:53:04

Victoria пишет:

По Станиславскому "...НЕ ВЕРЮ"

А зачем тут верить, когда без Вас Сильвия просто не сможет дать клиенту pdb-файл smile




2012.02.15 23:58:30

http://nanoworld.org.ru/topic/223/page/33/

Victoria пишет:

А.Ю., постарайтесь на меня не обижаться, но я не буду вступать в переписку с Сильвией ни от своего, ни от Вашего имени. Вы ведь тоже не делаете того, что Вам не интересно.

Кушелев: Уважаемая Виктория! Понятие "обида" для меня не существует. Что касается "неинтересно", то это может означать "непонятно". И мне нетрудно объяснить, почему Вам на самом деле интересно. Сильвия нам может помочь однозначно. Например, оповестив всех участников и гостей конкурса CASP о нашем существовании. При этом Вы ей ничего не должны smile




Кушелев: Администрация CASP удалила 4 сообщения из 5.

Вот, что осталось:http://predictioncenter.org/forcasp/vie … bf7044752b

При этом ответа так и не последовало. Список участников международного конкурса CASP10 организаторы держат в строгом секрете...

Зачем это нужно? Чтобы можно было незаметно избавиться от любого участника. Мой личный опыт показывает, что перед подведением итогов организаторы конкурса CASP избавляются даже от тех участников, которые есть в официальном списке.

В1998-ом году из списка участников исчезло 5 из 33:http://www.nanoworld.org.ru/data/01/dat … cafasp.htm

А которые не числятся в списке, о тех вообще речи нет. "Нет человека, и нет проблем" smile




http://nanoworld.org.ru/topic/297/page/29/

2012.06.11 10:48:57

3212-спираль напоминает бета-спираль, только имеет пятиричную симметрию (как и семеричная спираль, квазисимметрию, естественно).

http://img-fotki.yandex.ru/get/6311/158289418.1/0_7da25_d7edb744_L.jpg
Оригинал: http://img-fotki.yandex.ru/get/6311/158 … 4_orig.jpg

http://img-fotki.yandex.ru/get/6113/158289418.1/0_7da28_b47fee42_S.gif
Оригинал: http://img-fotki.yandex.ru/get/6113/158 … 2_orig.gif

Сбоку видны характерные ~прямые углы, как и в бета-спирали.




2012.06.11 12:27:46

Kushelev пишет:

13323133231

http://img-fotki.yandex.ru/get/6112/158289418.1/0_7da37_a13a54f7_L.jpg
Оригинал: http://img-fotki.yandex.ru/get/6112/158 … 7_orig.jpg

Эта конструкция напоминает складчатый бета-слой...

Анимированную картинку 1.7 Мб на Яндекс-фотки через Скай-линк загрузить не удаётся. Через GPRS тем более...

http://img-fotki.yandex.ru/get/6213/158289418.1/0_7da3b_69cc7971_S.gif
Оригинал: http://img-fotki.yandex.ru/get/6213/158 … 1_orig.gif

Не, всё-таки с 5-ого раза загрузилась smile



http://nanoworld.org.ru/topic/297/page/30/

2012.06.11 13:37:09

Kushelev пишет:

Любопытный повтор: 23323323 ... Интересно посмотреть на него в 3D...

http://img-fotki.yandex.ru/get/6113/158289418.1/0_7da3c_a0009b25_L.jpg
Оригинал: http://img-fotki.yandex.ru/get/6113/158 … 5_orig.jpg

http://img-fotki.yandex.ru/get/6113/158289418.1/0_7da3e_a22ac74_L.gif
Оригинал: http://img-fotki.yandex.ru/get/6113/158 … 4_orig.gif

Поворот до совмещения с соседним аминокислотным остатком происходит на 45 градусов, значит спираль имеет 8-ричную квазисимметрию.




2012.06.11 21:19:42

Kushelev пишет:

Интересные повторы 131313131313 и 31131131131. Напомню код спирали с семеричной симметрией: 331331331

http://img-fotki.yandex.ru/get/6312/158289418.1/0_7da97_4da8208d_L.jpg
Оригинал: http://img-fotki.yandex.ru/get/6312/158 … d_orig.jpg

311311311

http://img-fotki.yandex.ru/get/6113/158289418.1/0_7da99_deaf7ace_M.gif
Оригинал: http://img-fotki.yandex.ru/get/6113/158 … e_orig.gif

А эту конструкцию вы уже видели в рассылке "Новости лаборатории Наномир":http://nanoworld88.narod.ru/data/212.htm

http://img-fotki.yandex.ru/get/6312/158289418.1/0_7da9d_3d72bd27_M.gif
Оригинал: http://img-fotki.yandex.ru/get/6312/158 … 7_orig.gif

313131

http://img-fotki.yandex.ru/get/6113/158289418.1/0_7daa1_6ccda3bf_L.jpg
Оригинал: http://img-fotki.yandex.ru/get/6113/158 … f_orig.jpg




2012.06.11 22:51:33

http://www.scientific.ru/dforum/common/1336239463

Biolmol () - 06.05.2012 18:09
Re: CASP10 - международный конкурс предсказания белковых структур ...
В ответ на http://www.scientific.ru/dforum/common/1336143121:

Регистрация на CASP10 начнется в последнюю неделю марта 2012 года. Испытания подключение к серверу ("сухого хода" для сервера предикторов) будет проводиться начиная с 16 апреля 2012 года. Первое предсказание цели будет выпущен не ранее чем через 1 мая; последнее предсказание цели будет выпущен не позднее июля 17; прогноз сезон завершится не позднее 31 июля. Уточнение эксперимент закончится не позднее 17 августа. Тезисы описания методов испытания в CASP10 будут собраны в сентябре. В то же время мы откроем регистрацию на встречу. В программе встречи будут доступны в ноябре. Встреча состоится 9-12 декабря, и примерно за месяц до этой группы с наиболее точные прогнозы и интересные методы получать приглашения дать переговорам.
Постарайтесь не попасть в неудобную ситуацию, как один из участников тут
http://sandywest.narod.ru/pikoteh2.html

***

pasha A - 06.05.2012 18:11
Re: CASP10 - международный конкурс предсказания белковых структур ...
› › › в ответ на: Re: CASP10 - международный конкурс предсказания белковых структур ... – Biolmol
Снес пост Кушелева в связи с нарушениями правил форума. Ваш коммент вынес в отдельную ветку в связи с прикольностью указанной Вами ссылки.

Кушелев: А вот и "снесённый" администратором Scientific.ru мой пост:

Molbiol () - 04.05.2012 18:52
CASP10 - международный конкурс предсказания белковых структур ...

: Стартовал CASP10.
: Участники соревнуются в точности определения структуры белка.
:
: Типовая структура (interleukin-34):

http://img-fotki.yandex.ru/get/5506/126580004.42/0_b37ab_6493b0b7_orig.gif
:
: Этот белок состоит из двух почти одинаковых субъединиц.
:
: Гексамер инсулина ПОДРОБНО
:
: Этот белок состоит из 6 одинаковых субъединиц. Анимация показывает динамику. Гексамер регулирует концентрацию глюкозы.
:
: А так выглядит таблица для каждого участника конкурса:
:
: В течение ближайших дней можно принять участие в конкурсе: http://predictioncenter.org/
:
: Обсудить текущие вопросы можно на форуме FORCASP:
:
: http://predictioncenter.org/forcasp/vie … 6834ef1697
:
: В частности, предложен новый стандарт для конкурса: http://nanoworld88.narod.ru/forum/casp/004.htm





"Как Кушелев ставил свои условия организаторам конкурса CASP и CAFASP"

2012.06.11 23:10:20

Вот текст, на который дал "прикольную" ссылку Trilobit, что так понравилось админу Scientific.ru: http://sandywest.narod.ru/pikoteh2.html

Кушелев: Битые ссылки я подправил...

Цитата:

Как Кушелев ставил свои условия организаторам конкурса CASP и CAFASP.

Кушелев:

Я принимал участие в разных конкурсах. Некоторые были честными, некоторые - надуваловка. Это относится не только к России.

Надуть Вас могут и на международном конкурсе. Вот конкретный пример. Международный конкурс CASP и CAFASP. На этом конкурсе нужно определить структуры приблизительно 40 белковых молекул по аминокислотной последовательности.

Я сообщил руководству этого конкурса, что информация о структуре белка содержится не в аминокислотной последовательности самого белка, а в нуклеотидной последовательности кодирующий белок информационной РНК.

Кому интересно узнать структуру белка по коду, а вручную считать утомительно, предлагаем воспользоваться нашей компьютерной программой. Программа написана на стандартном Паскале и позволяет преобразовать генетический код белка в композиционный код его структуры, согласно нашей таблице.

То есть Кушелев попросил, чтобы условия конкурса изменили на более для него удобные.

Кушелев:

После этого руководитель конкурса прислал мне 40 нуклеотидных последовательностей белков, структуру которых выставили на конкурс. Конкурс длился ~2 месяца. Каждые два-три дня приходили новые коды, а решения из лаборатории Наномир выставлялись на сервер CASP. Вот копия базы данных, в которой наша лаборатория числилась под номером 33:

http://www.nanoworld.org.ru/data/01/dat … cafasp.htm

Трагическая ошибка Кушелева. Даже по окончанию ссылки видно, что это база данных CAFASP а вовсе не CASP!

Всё было хорошо до начала подведения итогов конкурса. В день подведения итогов из 33 участников неожиданно исчезло 5, в т.ч. лаборатория Наномир. Как будто мы и не участвовали в конкурсе.

А ведь так и есть! Кушелев хотел участвовать в конкурсе с другими условиями, но коварные организаторы не подчинились Кушелеву!
Если прогноз не будет принят CASP, а сервер разработчик не сможет исправить файл, затем этот прогноз будет удалён из CAFASP.

Кушелев:

Когда я поинтересовался, в чём дело, организатор сообщил, что по техническим причинам не может поставить данные, полученные от лаборатории Наномир на сервер.

Заметим, что по условиям конкурса организаторы и не должны были этого делать! Программа-участник должна была САМА отправить результат на сервер организаторов в требуемом формате.

Кушелев:- Но они же там уже были! - возразил я. На это мне уже ничего не ответили... Вот копия этой переписки:

Переписка на английском
Это прямая ложъ.
Кушелеву сообщили, что необходимо ознакомиться с условиями конкурса, где недвусмысленно напечатано:
Если прогноз не будет принят CASP, а сервер разработчик не сможет исправить файл, затем этот прогноз будет удалена из CAFASP.
Организатор конкурса Leszek просто из сил выбивался, чтобы помочь Кушелеву.
Leszek: У вас есть проблема в том, что есть некоторые технические требования к участию.
Мы не можем запустить все методы сами (я хочу найти время, чтобы сделать это).
Вот почему CAFASP будет сосредоточено только на серверах, которые дадут ответ на автоматизированный запрос посланный нами. Мы хотели бы отправить только аминокислотную последовательность, потому что мы считаем, что структура зависит от этого, а не только на основной последовательности ДНК, но мы могли бы попытаться сделать исключение (не обещаю). Но для этого нужно сервер, чтобы отправить нам ответ в автоматическом режиме.
Проверьте объявление CAFASP и оценка правил (http://www.cs.bgu.ac.il/ ~ dfischer/CAFASP2/evalr.html)
Пожалуйста, прочтите инструкции (!!!): http://www.cs.bgu.ac.il/ ~ dfischer/CAFASP2 / announce3.html (прилагается), формат CASP описано в: http://predictioncenter.llnl. gov/casp4/doc / casp4-format.html (прилагается).
CAFASP это особая дисциплина для серверов. Подводя итоги: вы можете настроить сервер для метода? С наилучшими пожеланиями,Leszek
Но Кушелев решил бороться до конца с правилами конкурса и с его организаторами:

Кушелев: -Мы готовы разместить сервер в вашем распоряжении, но ДНК-последовательность является необходимой в качестве вклада. Не будете ли Вы столь любезны дать нам образец входные данные с ДНК-последовательности, и мы подготовим программу в соответствии с ним на сервере. С наилучшими пожеланиями А. Кушелев.

-Я хотел бы использовать только формат PDB.

-Я считаю, что стандартные вторичные структуры это неправильно, так Я и послал вам только PDB.

-Мы не сделали сервер по техническим причинам, поэтому мы можем принять участие в CAFASP только через электронную почту.

Leszek: Но Вы, наверное, хотите, чтобы ваши предсказания были оценены как-то?
Но ваши результаты не будут оценены, если вы не представите CASP формат прогнозов.

Кушелев : Уважаемый сэр, я не нашел CASP Идентификационный номер нашего сервера. Так что я не знаю, если наши результаты были приняты во внимание. Не будете ли вы так добры, сообщите мне, что этим вопросом. С наилучшими пожеланиями А. Кушелев.

Leszek:Я не смог найти любую CASP отформатированные файлы с вашего сервера. С наилучшими пожеланиями.

Кушелев : Уважаемый сэр, мы направили наши результаты в формате CASP но они были отклонены. Таким образом, мы направили наши результаты только вам. Мы поняли вас, что вы включите наши результаты в базу данных под номером 33 (они находятся в базе данных CAFASP). Буду весьма признателен, если вы проясните ситуацию.

Ничего себе, несчастный Leszek оказывается должен переформатировать результаты Кушелева в нужный формат и разместить врукопашную на сервере!!!
Вообще-то это обязанность конкурсантов!

Кушелев: Уважаемый сэр, мы предсказывали 3D структуру объектов в формат PDB. Как я понял, вы лично вложили результаты в базе CAFASP данные под номером 33.
Я высоко ценю вашу волю, чтобы помочь нам.

Это Кушелев так издевается над одним из организаторов конкурса!

Это для нас очень важно знать, как работает наша программа. С наилучшими пожеланиями А. Кушелев

Напомним, оценке подвергалась вторичная структура!!! И наконец контрольный выстрел в голову Leszek.

Leszek: Вы думаете, 3D структуры или вторичная структура?

Кушелев: 3D-структуры только!

Было бы занятно посмотреть, каково было выражение лица Leszek, когда он прочитал это сообщение. И какие слова он произнёс.

Кушелев: На следующий год в лабораторию Наномир снова пришло приглашение участвовать в конкурсе CASP. Я ответил, что мы будем участвовать при условии, что будут опубликованы наши результаты предыдущего конкурса, где эксперты объяснят, куда делись наши данные. После этого организаторы CASP больше не беспокоят лабораторию Наномир.
И правильно.
А то придётся ещё программу за Кушелева доделывать и на первое место продвигать! А уж объяснить Кушелеву в чём его ошибки может и жизни не хватить.

© 2009 "Офигеология без границ"

Конец цитаты.






Кушелев: Переписка с организатором CASP: http://www.nanoworld.org.ru/data/01/dat … leszek.txt

Подведём итог. Организаторы CASP за 14 лет не обратили внимание на открытие композиционного кода. Все эти годы десятки конкурсантов "бились саблями", когда рядом "лежал пулемёт" smile

Они и сегодня уничтожают любую информацию о пикотехнологии на форуме ForCASP smile

Какова же их цель? Зачем десятилетиями биться (и бить десятки исследовательских групп!) головой об стену, когда проблема давно решена?





2012.06.12 01:21:04

А.Ю., зачем сотрясать зря воздух? Принимая участие в конкурсе нужно делать всё самостоятельно: находить нуклеотидные последовательности для задач конкурса (что совсем не сложно), убирать клеш из декодированных структурных шаблонов белков (минимизировать их по энергии системы), загружать pdb. файлы белков на сайте конкурса и др.
Например, Вы с клешем справились? Если да, то Ваши модели я загружу на конкурс. Если нет, то изучайте матчасть smile.




2012.06.12 10:08:05

Victoria пишет:

А.Ю., зачем сотрясать зря воздух? Принимая участие в конкурсе нужно делать всё самостоятельно: находить нуклеотидные последовательности для задач конкурса (что совсем не сложно), убирать клеш из декодированных структурных шаблонов белков (минимизировать их по энергии системы), загружать pdb. файлы белков на сайте конкурса и др.
Например, Вы с клешем справились? Если да, то Ваши модели я загружу на конкурс. Если нет, то изучайте матчасть smile.





Кушелев: При чём тут вообще конкурс? Десятки исследовательских групп десятками лет толкут воду в ступе, когда у них под носом развивается пикотехнология. Это значит, что к науке деятельность всех этих "учёных" не имеет отношения.

Что касается подготовки данных на конкурс, то я этим занимаюсь по мере возможности. Сегодня начинаю делать PDB-файлы белков от 691. Что касается клиринга, то попробуем. Хотя по большому счёту это - пустая трата времени.

Оценивать точность пикотехнологических моделей будут (если вообще будут) по ошибочным гипотезам, поэтому призовое место займёт не тот, кто даст более точные к реальности данные, а тот, кто даст данные, максимально близкие к ошибочным, но официальным представлениям. Победа в таком конкурсе - позор для исследователя smile


2012.06.12 12:31:55

Пикотехнологические модели конкурсных белков с 691 по 708 (по два вида)

(смотреть через зеркало)


http://img-fotki.yandex.ru/get/6112/158289418.1/0_7db07_7aca93ac_L.pnghttp://img-fotki.yandex.ru/get/6113/158289418.1/0_7db08_9ba4dd61_L.pnghttp://img-fotki.yandex.ru/get/6310/158289418.1/0_7db0d_3ceecc79_L.png
http://img-fotki.yandex.ru/get/6213/158289418.2/0_7db12_ff56c668_L.pnghttp://img-fotki.yandex.ru/get/6312/158289418.2/0_7db13_9946c6f6_L.pnghttp://img-fotki.yandex.ru/get/6310/158289418.2/0_7db15_e4baca22_L.png
http://img-fotki.yandex.ru/get/6312/158289418.2/0_7db1c_b928468b_L.pnghttp://img-fotki.yandex.ru/get/6112/158289418.2/0_7db1e_ffdad90e_L.pnghttp://img-fotki.yandex.ru/get/6311/158289418.2/0_7db23_d7056661_L.png
http://img-fotki.yandex.ru/get/6311/158289418.2/0_7db28_a537055e_L.pnghttp://img-fotki.yandex.ru/get/6113/158289418.2/0_7db2e_ffae659f_L.pnghttp://img-fotki.yandex.ru/get/6313/158289418.2/0_7db2a_90cf322d_L.png