Перевести страницу

Классическая волновая физика радиоэфира Фарадея-Максвелла

Рубиновая энергетика и эфироопорные двигатели

Пикотехнология белков

Биотехнология вечной молодости

Исследования мегалитов

Инопланетная инженерия




Определены структуры всех белков человека



ПИКОТЕХНОЛОГИЯ БЕЛКОВ ДАЙДЖЕСТ


660 выпуск рассылки


Определены структуры всех белков человека


   


На базе научного открытия нами создан онлайн-сервис по определению структуры белковых молекул. Теперь мы сможем зарабатывать вместе.


По старой технологии определение одной структуры белка обходится примерно в 10 000 евро, а ждать нужно от 2 месяцев до 3 лет. По новой технологии структура определяется в 1000 раз точнее и в миллиард раз быстрее. 80% от найденного Вами заказа принадлежат Вам, как менеджеру.


Наш лозунг: "В 1000 раз лучше, в 1000^3 быстрее и в 1000 раз дешевле!"


Ваша задача заключается в размещении рекламы на онлайн-сервис белковых структур. Рынок этих структур очень большой и продолжает стремительно расти. Ежедневно кто-то оплачивает до 60 структур по средней цене 10 000 евро за штуку. Новая технология позволила на одном персональном компьютере за неделю определить структуры всех 115 000 белков человека, для которых известна нуклеотидная кодирующая последовательность. При этом качество результата, полученного по новой технологии в 1000 раз выше по точности, в миллиард раз по быстродействию и в 30 раз шире по номенклатуре белковых молекул. Единственное, что нам сегодня не хватает - рекламы.


Как получить Вашу первую зарплату менеджера? Найти заказчика белковых структур  и убедить его заказать за счёт лаборатории Наномир пробный заказ. Когда заказчик распробует новую технологию, он начнёт делать коммерческие заказы. С первого коммерческого заказа менеджер получает 80%. С последующих заказов процент будет постепенно уменьшаться, но с первого заказа другого заказчика менеджер снова получит 80%. Зарплата менеджера может достичь миллиона евро в день. И это не предел.


https://img-fotki.yandex.ru/get/107080/158289418.3c1/0_1705b1_dc9f55fd_M.gif https://img-fotki.yandex.ru/get/169883/158289418.3b3/0_16f622_63ae0418_M.gif

Фрагменты моделей белков, замкнувшихся через дисульфидные мостики в процессе автоматической сборки по таблице композиционного генетического кода.

https://img-fotki.yandex.ru/get/371487/158289418.4bc/0_18a588_ce47e849_orig.gif


"Монстр" первой хромосомы человека насчитывает 5207 аминокислотных остатков.

Вторичные структуры белков в компантном изображении: 



 


Первая 1000 белковых структур за счёт лаборатории Наномир (по старой технологии это стоило бы 10 миллионов евро). 

Обсуждение



Говорит и показывает Пикотех - апрель 2017. Текущая погрешность модели. Уточнение композиционных углов. Сравнение алгоритмов Кушелева и Соколик.



Проект Пикотехнология Белков Оналйн


                                                                                                                                              

Пикотехнология белков, ДНК, РНК. Часть 1

Пикотехнология белков, ДНК, РНК. Часть 2   

Пикотехнология белков, ДНК, РНК. Часть  3



https://www.ncbi.nlm.nih.gov/protein/74 … SDMTTNU015

https://www.ncbi.nlm.nih.gov/nuccore/743960172

>ENA|BAQ14176|complement 2013 nucleotides

Фрагмент:

https://img-fotki.yandex.ru/get/235015/158289418.408/0_1789ec_3ca8357b_orig.png

https://img-fotki.yandex.ru/get/198613/158289418.408/0_1789ed_bab1c6f4_orig.png

https://img-fotki.yandex.ru/get/114207/158289418.408/0_1789ee_7b85f5c2_orig.png

Изменение бета- и пи- композиционных углов существенно изменило форму модели фрагмента белка.



https://www.ncbi.nlm.nih.gov/protein/11 … SDMTTNU015

https://www.ncbi.nlm.nih.gov/nuccore/1145424954

>ENA|SJN11245|4035 nucleotides

Фрагмент:

https://img-fotki.yandex.ru/get/218038/158289418.408/0_1789f2_e257495e_orig.png

https://img-fotki.yandex.ru/get/102548/158289418.408/0_1789f3_66042d1b_orig.png

https://img-fotki.yandex.ru/get/102548/158289418.408/0_1789f4_bb72d67a_orig.png

Изменение углов бета- и пи-спиралей превратило явно неправильную форму модели в более осмысленную. К сожалению точная настройка углов - дело кропотливое даже с использованием интерактивной версии Пикотех. Так что придётся подождать до её создания...



https://www.ncbi.nlm.nih.gov/nuccore/292397674

https://img-fotki.yandex.ru/get/216915/158289418.407/0_178961_995b7be0_orig.png

Развернуто: https://img-fotki.yandex.ru/get/232875/ … 6_orig.png

https://img-fotki.yandex.ru/get/102548/158289418.407/0_178962_b6f571b3_orig.png
Напомню, что наиболее точно показаны углы афльа- и 310-спиралей. Погрешность углов бета- и пи-спиралей может достигать 30 градусов.



https://www.ncbi.nlm.nih.gov/nuccore/292397674

Любопытно, что весь геном не содержит ни одного стоп-кодона, т.е. по геному можно собрать один гигантский белок.

https://img-fotki.yandex.ru/get/218038/ … b_orig.png







Формы, механизмы, энергия наномира. Сообщение 87 307

Пикотехнология белков, ДНК, РНК - 3

Продолжаем исследовать геном: https://www.ncbi.nlm.nih.gov/nuccore/292397674

https://img-fotki.yandex.ru/get/215803/158289418.408/0_1789bc_b6f420d1_orig.png

https://img-fotki.yandex.ru/get/41743/158289418.408/0_1789bb_d84905cd_L.png

https://img-fotki.yandex.ru/get/215803/158289418.408/0_1789bd_349ec7fc_orig.png

https://img-fotki.yandex.ru/get/94596/158289418.408/0_1789be_b099026e_orig.png

https://img-fotki.yandex.ru/get/195431/158289418.408/0_1789bf_768bc4e9_orig.png

https://img-fotki.yandex.ru/get/194492/158289418.408/0_1789c0_b5d5cb01_orig.png

https://img-fotki.yandex.ru/get/246155/158289418.408/0_1789c1_64997b56_orig.png

Следующий фрагмент:

https://img-fotki.yandex.ru/get/230858/158289418.408/0_1789c3_7130a3ff_orig.png

https://img-fotki.yandex.ru/get/215803/158289418.408/0_1789c2_4b5cf374_L.png

https://img-fotki.yandex.ru/get/246155/158289418.408/0_1789c4_9a3df7fe_orig.png

https://img-fotki.yandex.ru/get/25921/158289418.408/0_1789c5_ce0e1d1f_orig.png

https://img-fotki.yandex.ru/get/104083/158289418.408/0_1789c6_30753229_orig.png

https://img-fotki.yandex.ru/get/109878/158289418.408/0_1789c7_5ccff731_orig.png

https://img-fotki.yandex.ru/get/172017/158289418.408/0_1789c8_6ee7e54_orig.png

https://img-fotki.yandex.ru/get/172017/158289418.408/0_1789c9_7a5c3941_orig.png

Следующий фрагмент:

https://img-fotki.yandex.ru/get/54522/158289418.408/0_1789cb_be5f53fb_orig.png

https://img-fotki.yandex.ru/get/246231/158289418.408/0_1789ca_26e315bb_L.png

https://img-fotki.yandex.ru/get/194492/158289418.408/0_1789cc_f32b8a9d_orig.png

https://img-fotki.yandex.ru/get/195990/158289418.408/0_1789cd_c36786fc_orig.png

https://img-fotki.yandex.ru/get/96803/158289418.408/0_1789ce_cd5b13ea_orig.png

https://img-fotki.yandex.ru/get/230858/158289418.408/0_1789cf_696dea71_orig.png

https://img-fotki.yandex.ru/get/215803/158289418.408/0_1789d0_9cad4d65_orig.png

https://img-fotki.yandex.ru/get/176331/158289418.408/0_1789d1_26f8d604_orig.png

https://img-fotki.yandex.ru/get/215803/158289418.408/0_1789d2_5cce9287_orig.png

"Строчка Кушелева" или "вперёд иголочкой 3D" smile

Кстати, при дальнейшем уточнении композиционных углов может оказаться, что это своеобразная белковая структура "вязание" или "вязь".

Мы уже встречались с белковой "вязью": http://nanoworld.org.ru/topic/1670/page/3/

https://img-fotki.yandex.ru/get/177849/158289418.405/0_17875b_f1ed5bdb_XL.gif
Кстати, при уточнении композиционных углов эта "вязь" может изменить топологию, т.е. петли могут захватывать не одну, а две "нити".



Формы, механизмы, энергия наномира. Сообщение 87 309

Письмо Дидье Маруани / Didier Marouani от Кушелева

Пикотехнология белков, ДНК, РНК - 3

Открыта музыка белка с размером 7/8 (Lymantria_genom)

Размер 7/8 интересен тем, что в земной музыке не используется (пока) wink

https://img-fotki.yandex.ru/get/246231/158289418.408/0_1789ca_26e315bb_XL.png

https://img-fotki.yandex.ru/get/246231/158289418.408/0_1789d6_dcf8ef5e_orig.png
Под музыку с музыкальным размером 7/8 строится переходная (спираль-вязь) белковая структура:

https://img-fotki.yandex.ru/get/195990/158289418.408/0_1789cd_c36786fc_orig.png
Это ещё спираль, но она уже близка к структуре "псевдовязь".

https://img-fotki.yandex.ru/get/215803/158289418.408/0_1789d2_5cce9287_orig.png
Это уже "псевдовязь"

https://img-fotki.yandex.ru/get/177849/158289418.405/0_17875b_f1ed5bdb_XL.gif
А это уже "вязь".



Формы, механизмы, энергия наномира. Сообщение 87 254

Пикотехнология белков, ДНК, РНК - 3

Ищем PGAPGAPGAPGAPGAPGAPGAPGAPGAPGAPGA

https://blast.ncbi.nlm.nih.gov

https://www.ncbi.nlm.nih.gov/protein/11 … NZ5DF0H014

https://www.ncbi.nlm.nih.gov/nuccore/1101224483

OIP72816

http://molbiol.ru/scripts/01_12.html

>ENA|OIP72816|complement 228 nucleotides
atgggtaatagaaacagtttaccttgcctgcctcccggtgctcccggtgctcccggtgct
cccggtgctcccggtgctcccggtgctcccggtgctcccggtgctcccggtgctcccggc
gctcccggtgcctcctggtgcccaatcttcccgattccccctcaaatcctttgtaggatc
ttgttaatcctagaccagtgttggcaaattttctccacttgtttataa

https://img-fotki.yandex.ru/get/223280/158289418.406/0_178861_4ee3666e_orig.png

Развернуто: https://img-fotki.yandex.ru/get/218579/ … 0_orig.png

https://img-fotki.yandex.ru/get/50936/158289418.406/0_17885c_9729af4b_orig.png

https://img-fotki.yandex.ru/get/97884/158289418.406/0_17885d_9ea5051e_orig.png

https://img-fotki.yandex.ru/get/50936/158289418.406/0_17885e_e5d06b40_orig.png

https://img-fotki.yandex.ru/get/243492/158289418.406/0_17885f_539c791e_orig.png

https://img-fotki.yandex.ru/get/226827/158289418.406/0_178860_659cff44_orig.png


Кушелев:

Похоже, что минимальная погрешность у модели со значением угла -30 градусов. Однако нужно учесть, что каждый композитный угол в программе реализован через три ортогональных угла. Из 6 композиционных кодов пока реализовано лишь 4. Не учитываются свойства пролина. А главное, что это геометрический алгоритм, т.е. физико-химические взаимодействия тоже не учитываются.

Так что пока надёжным результатом программы Пикотех является только вторичная структура белка. Над третичной придётся ещё поработать. Создать интерактивную версию, настроить все композиционные углы, а в следующей версии учесть физико-химические взаимодействия. Тогда пикотехнологические 3D модел белков будут реалистичными. Пока это можно назвать условными 3D-схемами, где отчётливо видны регулярные структуры, но композиционные углы показаны приближённо. Наиболее точно настроен угол альфа-спирали. Углы бета- и пи-спирали настроены с погрешностью до 30 градусов. smile



Формы, механизмы, энергия наномира. Сообщение 87 229

Пикотехнология белков, ДНК, РНК - 3

Программные белковые спирали помогают уточнить композиционные углы

https://img-fotki.yandex.ru/get/241199/158289418.405/0_17875d_f2a6832c_orig.png
Неточный композиционный угол пи-спирали приводит к "слипанию" витков программной спирали.

https://img-fotki.yandex.ru/get/42618/158289418.405/0_17875e_fb9092e0_orig.png
Варьированием композиционного угла (в скрипте приходится менять три угла, соответствующих одному композиционному коду) можно добиться правильных параметров пи-спирали и программных спиралей, содержащих композиционный код "3".

https://img-fotki.yandex.ru/get/105284/158289418.405/0_17875c_e1e3ebe9_orig.png

https://img-fotki.yandex.ru/get/177849/158289418.405/0_17875b_f1ed5bdb_XL.gif

Более точную настройку композиционных углов можно будет осуществить в интерактивной 3D-версии Пикотех, которую планируется создать.



Формы, механизмы, энергия наномира. Сообщение 87 173

Пикотехнология белков, ДНК, РНК - 3

https://www.ncbi.nlm.nih.gov/protein/64 … CUUFV1Y013

https://www.ncbi.nlm.nih.gov/nuccore/641581791

>ENA|CDO63795|14214 nucleotides

Фрагмент:

https://img-fotki.yandex.ru/get/217607/158289418.400/0_178553_39d36750_orig.png

https://img-fotki.yandex.ru/get/48807/158289418.400/0_178555_68349cf2_orig.png

https://img-fotki.yandex.ru/get/217607/158289418.400/0_178552_b3ebb67c_orig.png

https://img-fotki.yandex.ru/get/201221/158289418.400/0_178554_22ab089d_orig.png



Программные белковые спирали помогают уточнить композиционные углы

Татьяна Рясина пишет:

Алексанрд Юрьвич, Вам зачот по телепатии
Хотела спросить, для чего вы удлиняете спирали )))))).
Может быть Вы, ищете управляющие коды следующего уровня  через принципы  симметрии, что-то вроде языка программирования, который читается через нуклеотидную последовательность.  Слава Богу, всё яснее и проще - сложно это не хорошо )))))).

Кушелев:

Я сам не знал, что программные спирали помогут уточнить композиционные углы. Но так получилось...



Посмотрим, как будет выглядеть модель программной 35-спирали (Q-спирали) при разных значениях одного из трёх компонент композиционного угла пи-спирали.

https://img-fotki.yandex.ru/get/239438/158289418.405/0_1787f7_5b22868e_orig.png

https://img-fotki.yandex.ru/get/251308/158289418.405/0_1787fb_da7c81c1_orig.png

https://img-fotki.yandex.ru/get/239438/158289418.405/0_1787f6_3a7a775c_orig.png

https://img-fotki.yandex.ru/get/242441/158289418.405/0_1787f8_ea83628b_orig.png
Первая составляющая композиционного угла = -30 градусов.

https://img-fotki.yandex.ru/get/102548/158289418.405/0_1787fa_6059c2bc_orig.png

https://img-fotki.yandex.ru/get/242441/158289418.405/0_1787f9_bdf8bbc_orig.png

https://img-fotki.yandex.ru/get/202427/158289418.405/0_1787fc_65fe6898_orig.png
-20 градусов

https://img-fotki.yandex.ru/get/50936/158289418.405/0_1787fd_3f3ef421_orig.png

https://img-fotki.yandex.ru/get/239438/158289418.405/0_1787ff_ec74f186_orig.png
-10 градусов

https://img-fotki.yandex.ru/get/104700/158289418.405/0_178800_6eedd5a0_orig.png
-5 градусов

https://img-fotki.yandex.ru/get/194858/158289418.405/0_178801_89256618_orig.png

https://img-fotki.yandex.ru/get/194835/158289418.405/0_17880a_761f2886_orig.png
-30

https://img-fotki.yandex.ru/get/246231/158289418.405/0_178802_acc3b5d7_orig.png
-30

https://img-fotki.yandex.ru/get/249782/158289418.405/0_178809_945f4a83_orig.png
-20

https://img-fotki.yandex.ru/get/194835/158289418.405/0_178803_7b9385e2_orig.png
-20

https://img-fotki.yandex.ru/get/108697/158289418.405/0_178808_b13d30dc_orig.png
-10

https://img-fotki.yandex.ru/get/216915/158289418.405/0_178804_9a2ba4c7_orig.png
-10

https://img-fotki.yandex.ru/get/143523/158289418.405/0_178807_ab063ec1_orig.png
-5

https://img-fotki.yandex.ru/get/244791/158289418.405/0_178806_931bf82d_orig.png
-5

https://img-fotki.yandex.ru/get/242441/158289418.405/0_178805_e2aa47d8_orig.png
-5

Осталось выбрать наиболее правильную модель. Для этого нужно узнать экспериментальные значения числа аминокислотных остатков на виток Q-спирали, радиус и шаг спирали. Возможно, что эти данные уже имеются в Protein Data Base...



Формы, механизмы, энергия наномира. Сообщение 87 250

Пикотехнология белков, ДНК, РНК - 3

Программные белковые спирали помогают уточнить композиционные углы

Продолжаем уточнять композиционные углы...

http://subscribe.ru/archive/science.new … 2016.html/

https://img-fotki.yandex.ru/get/246231/158289418.405/0_178802_acc3b5d7_orig.png

https://img-fotki.yandex.ru/get/242441/158289418.405/0_178805_e2aa47d8_orig.png

Кушелев: Здесь видно, что изменение одной из составляющих угла пи-спирали с -30 до -5 градусов меняет правую 35-спираль (Q-спираль) на левую. А это значит, что можно провести сравнительно дешёвый эксперимент с измерением вращения поляризации света в растворе, содержащим Q-спираль белка. Эксперимент поможет выяснить, является ли Q-спираль правой или левой. А вместе с этим определится и композиционный угол пи-спирали. Хотя модельный эксперимент может оказаться ещё проще и дешевле.

http://www.nanoworld.org.ru/data/01/data/avi/bio.gif




Пикотехнология белков, ДНК, РНК - 3

https://www.ncbi.nlm.nih.gov/protein/59 … GY7BKE3014

https://www.ncbi.nlm.nih.gov/nuccore/597863140

EYC12612

http://molbiol.ru/scripts/01_12.html

>ENA|EYC12612|complement 978 nucleotides
atggcgcataagaactacacaatatactactactactactactactactactactactac
tactactactactactactactactactactactactactactactactactactactac
tactactactactactactactactactactactactactactactactactactactac
tactactactactactactactactactactactactactactactactactactactac
tactactactactactactactactactactactactactactactactactactactac
tactactactactactactactactactactactactactactactactactactactac
tactactactactactactactactactactactactactactactactactactactac
tactactactactactactactactactactactactactactactactactactactac
tactactactactactactactactactactactactactactactactactactactac
tactactactactactactactactactactactactactactactactactactactac
tactactactactactactactactactactactactactactactactactactactac
tactactactactactactactactactactactactactactactactactactactac
tactactactactactactactactactactactactactactactactactactactac
tactactactactactactactactactactactactactactactactactactactac
tactactactactactactactactactactactactactactactactactactactac
tactactactactactactactactactactactactactactactactactactactac
tactactactactactaa

https://img-fotki.yandex.ru/get/194549/158289418.405/0_1786df_87810cd1_orig.png

Развернуто: https://img-fotki.yandex.ru/get/57797/1 … 8_orig.png

https://img-fotki.yandex.ru/get/25921/158289418.405/0_1786e0_966a7f3_orig.png

https://img-fotki.yandex.ru/get/470815/158289418.405/0_1786e1_1d124a65_orig.png

https://img-fotki.yandex.ru/get/196631/158289418.405/0_1786e2_df2cfdc9_orig.png

https://img-fotki.yandex.ru/get/402270/158289418.405/0_1786e3_6321e951_orig.png

Это достаточно длинный (более 300 аминокислотных остатков), но не рекордный прямой участок альфа-спирали белка, состоящий только из Tyr (остатков тирозина)

Напомню, что рекорд для прямого участка альфа-спирали 502 аминокислотных остатка: http://subscribe.ru/archive/science.new … 0048.html/

https://img-fotki.yandex.ru/get/196365/158289418.3ff/0_1784e9_d77a01c0_orig.png



Формы, механизмы, энергия наномира. Сообщение 87 173

Пикотехнология белков, ДНК, РНК - 3

https://www.ncbi.nlm.nih.gov/protein/64 … CUUFV1Y013

https://www.ncbi.nlm.nih.gov/nuccore/641581791

>ENA|CDO63795|14214 nucleotides

Удлиним фрагмент:

https://img-fotki.yandex.ru/get/228104/158289418.400/0_178557_3b1bfac4_orig.png

https://img-fotki.yandex.ru/get/52461/158289418.400/0_17855b_d5df9b2d_orig.png

https://img-fotki.yandex.ru/get/196258/158289418.400/0_178556_64e20c4e_orig.png

https://img-fotki.yandex.ru/get/194858/158289418.400/0_178558_4cfb6d65_orig.png

Эта программная 52332233-спираль вдоль оси симметрии выглядит, как "цветик-семицветик" smile

https://img-fotki.yandex.ru/get/52461/158289418.400/0_17855e_5a0316e1_orig.png

https://img-fotki.yandex.ru/get/218038/158289418.400/0_17855a_c0e8de1d_orig.png

https://img-fotki.yandex.ru/get/196258/158289418.401/0_178564_9003769e_orig.png

https://img-fotki.yandex.ru/get/104403/158289418.401/0_178565_fb4b46d1_orig.png

Рассмотрим второй подфрагмент и удлиним.

https://img-fotki.yandex.ru/get/195990/158289418.401/0_178568_b38ec28b_orig.png

https://img-fotki.yandex.ru/get/48807/158289418.401/0_17856c_85398970_orig.png

https://img-fotki.yandex.ru/get/194503/158289418.401/0_178569_1d5d111a_orig.png

https://img-fotki.yandex.ru/get/195990/158289418.401/0_178570_3158aa34_orig.png

https://img-fotki.yandex.ru/get/366459/158289418.401/0_178571_ba2c38c4_orig.png

https://img-fotki.yandex.ru/get/105020/158289418.401/0_17857c_e4d780df_orig.gif

И ещё один фрагмент:

https://img-fotki.yandex.ru/get/94596/158289418.401/0_178573_1ace1da6_orig.png

https://img-fotki.yandex.ru/get/170749/158289418.401/0_178577_49931586_orig.png


https://img-fotki.yandex.ru/get/231315/158289418.401/0_178574_49adec25_orig.png

https://img-fotki.yandex.ru/get/114207/158289418.401/0_178576_6473b15d_orig.png

https://img-fotki.yandex.ru/get/99813/158289418.401/0_178578_9474ae93_orig.png

https://img-fotki.yandex.ru/get/170749/158289418.401/0_178579_ec130458_orig.png

https://img-fotki.yandex.ru/get/226123/158289418.401/0_17857a_b0d3e989_orig.png

https://img-fotki.yandex.ru/get/96803/158289418.401/0_17857b_f9093be0_orig.png

В белковых спиралях ось симметрии обычно бывает дробного, иррационального, действительного порядка. При этом водородные связи могут образоваться с каждым вторым, третьим, четвертым... аминокислотным остатком.



Формы, механизмы, энергия наномира. Сообщение 87 183

Пикотехнология белков, ДНК, РНК - 3

https://www.ncbi.nlm.nih.gov/nuccore/641581791


Удлиним...

https://img-fotki.yandex.ru/get/53993/158289418.401/0_1785d8_b5d96945_orig.png

https://img-fotki.yandex.ru/get/108697/158289418.402/0_1785db_90802362_orig.png


https://img-fotki.yandex.ru/get/55231/158289418.402/0_1785da_aefd87c7_orig.png

https://img-fotki.yandex.ru/get/105020/158289418.402/0_1785d9_8168b4b_orig.png

https://img-fotki.yandex.ru/get/25921/158289418.402/0_1785d6_e8bedd97_orig.gif


Ещё удлиним...


https://img-fotki.yandex.ru/get/46400/158289418.402/0_1785e1_b3714b2c_orig.png

https://img-fotki.yandex.ru/get/53078/158289418.402/0_1785de_ea5af989_orig.png

https://img-fotki.yandex.ru/get/108697/158289418.402/0_1785df_7a71cb36_orig.png

https://img-fotki.yandex.ru/get/105020/158289418.402/0_1785e0_722837dd_orig.png

https://img-fotki.yandex.ru/get/225029/158289418.402/0_1785e2_2f67004f_orig.png

https://img-fotki.yandex.ru/get/105020/158289418.402/0_1785e3_2247a57d_orig.png

https://img-fotki.yandex.ru/get/225029/158289418.402/0_1785e4_cf77b2dd_orig.png

https://img-fotki.yandex.ru/get/225029/158289418.402/0_1785e5_35c2f872_orig.png

https://img-fotki.yandex.ru/get/196161/158289418.402/0_1785e6_657310bf_orig.png

https://img-fotki.yandex.ru/get/196161/158289418.402/0_1785e7_90f8bdec_orig.png

https://img-fotki.yandex.ru/get/53145/158289418.402/0_1785e8_1bd0e109_orig.png

https://img-fotki.yandex.ru/get/196161/158289418.402/0_1785e9_f8bf81e0_orig.png

https://img-fotki.yandex.ru/get/96803/158289418.402/0_1785ea_20449840_orig.png

https://img-fotki.yandex.ru/get/105020/158289418.402/0_1785eb_d93fb41c_orig.png

https://img-fotki.yandex.ru/get/228104/158289418.402/0_1785ec_16e6f898_orig.png
Один фрагмент белковой молекулы сложнее, чем "календарь" Майя smile




Пикотехнология белков, ДНК, РНК - 3

https://www.ncbi.nlm.nih.gov/protein/70 … CUUFV1Y013

https://www.ncbi.nlm.nih.gov/nuccore/700200443

>ENA|KGN58390|complement 3366 nucleotides

https://img-fotki.yandex.ru/get/105020/158289418.401/0_178592_1df41495_orig.png


https://img-fotki.yandex.ru/get/111568/158289418.401/0_178595_b21ee814_orig.png


https://img-fotki.yandex.ru/get/232875/158289418.401/0_178593_9513dcee_orig.png

https://img-fotki.yandex.ru/get/212758/158289418.401/0_178594_25ef477a_orig.png

Фрагмент:

https://img-fotki.yandex.ru/get/141254/158289418.401/0_178584_f27fcbd_orig.gif

Вторичная структура полностью: https://img-fotki.yandex.ru/get/170815/ … 0_orig.gif



Пикотехнология белков, ДНК, РНК - 3

Кушелев: Регулярные белковые молекулы (программные спирали) помогают сравнить разные алгоритмы определения вторичной структуры:

https://img-fotki.yandex.ru/get/61897/158289418.401/0_17857d_3145a1c1_orig.gif

https://img-fotki.yandex.ru/get/105020/158289418.401/0_17857c_e4d780df_orig.gif

https://img-fotki.yandex.ru/get/219501/158289418.401/0_17857e_ac49feb3_orig.gif

https://img-fotki.yandex.ru/get/198998/158289418.401/0_178566_e89d1890_orig.png

https://img-fotki.yandex.ru/get/141254/158289418.401/0_178584_f27fcbd_orig.gif
Вторичная структура полностью: https://img-fotki.yandex.ru/get/170815/ … 0_orig.gif


Рассмотрим ещё один фрагмент этого белка: https://www.ncbi.nlm.nih.gov/nuccore/641581791

https://img-fotki.yandex.ru/get/198569/158289418.400/0_178551_85a4502d_orig.png

Фрагмент:

https://img-fotki.yandex.ru/get/195431/158289418.401/0_17858d_ef73e04c_orig.png

https://img-fotki.yandex.ru/get/239438/158289418.401/0_178588_29e022_orig.png

https://img-fotki.yandex.ru/get/366459/158289418.401/0_178589_8de3c4f7_orig.png

https://img-fotki.yandex.ru/get/56406/158289418.401/0_17858a_2281070b_orig.png

https://img-fotki.yandex.ru/get/104595/158289418.401/0_17858b_7ebf07b5_orig.png

https://img-fotki.yandex.ru/get/249782/158289418.401/0_17858c_6baa98e5_orig.png

Эта структура тоже помогает сравнить разные алгоритмы:

https://img-fotki.yandex.ru/get/198613/158289418.401/0_17858f_4805b4d6_orig.png



https://www.ncbi.nlm.nih.gov/protein/92 … NZ5DF0H014

https://www.ncbi.nlm.nih.gov/nuccore/921130435

>ENA|XP_013439753|1851 nucleotides
atgagagcagcagcagcagcaaaggcagcaaacctggcgggcgacagggccgcgtggggc
ccccccgcagcagcagcagcagcagcagcagcagcagcgcctgctgcgccgccagcagca
gcaggaggcgaagtgctgcagcagctgctgtcggcggcgctgagccgcttcgagggcctc
gccctcgagcgcatgcaaagctatgtgcagcaggagtggggcccccggcagcagcagctg
cagcaggaagcaaataaagcagcagacttgaacttggccttattggaggccctggacttg
gacaaactcagcacagaagacctgcaggcagttctttctttgtccgaagacatccagcgc
caggggcccccctccgaggcagcagcagcggcccggggggccccccggggcccccggggc
ccccgggggggggcccccacagcccgcagcagcagcagcgggggccccccagtctttgcc
cagtcctgctgcggccggcccggccgcccgcagggcccagagggggcccccagcggcctg
gcctcgccggggctgctggggggcccccaggggggccccctggggggcccccaggggagc
ccgctggggggcccccaggggggccccctggggggccccctgggggcccccaacgaggaa
ctggctggggcccccacggacttcgttgtgaccccccggggctccattagagaagcttct
gctgccttgaggcactggagagacttgctggactatatggatgaaagagatggctttttg
gacatgttgcggggcagcgaaagtggcagagacgtggggtgtacgtacaccccaggcggg
cggcgggcccaggggcggcgcgcggctgcaaagggcaaagaaagaactgctgcagacaag
gcagcgagcccccccacggggtccgcagcagcagcagcagcagcagctgctgcagcagca
gcagcagcaggggaggcagcagcagcagaagccggcgcggggggccccacgggcgcctcc
gcgctggctgctgctgctgctgctgctgctgctgctgctggcctcatcgactgcagcaac
ggcaaagccagcccctcggctctcagcagcagggcctcccgccggcggtctcgccaagtg
ctgcagaagaaagcaggaggttcgaaggacttctcgggggcccccctcgagggggtcgag
tggcccgagggggcccccggaaagaggcactgcccggggtctccctgcagccgcttctcc
gcattatgcgaggcttgcgagggcctcgcaagtcccccggggttggctgtggggtctgct
gctgctgctgctgctgctgctgctgcggatgccgcgtacctgtggccgcaggggcccgag
cgcagcagcagcagcagcagcagcagcagcagcagcagcggggcggccggcgcagcgcag
gagggggggcccccgcccccactcgcccgcggcagcttcgcgggcaagaagggcccccgg
ggggcccccgcgagcagcagacaaaggtgtttgtcccccttgtgtctcgacgacatgctc
aaaatcgtctggggggcccccagggaggccgcagcccttattctcaacgacgcgcagcca
ggggccccaggggccccaggggccccaggggccccaggggccccgggggccccgggggcc
ccgggggccccgggggccccgggggccccgggggcttcaggggcttcaggggccccgggg
gccccgggggcttcaggggcccctggggcccccaaagaggccctttgtgttggccggaaa
gcggcagcgccttttggaaatgagcagtgctgctccgttaaggaggagtag

https://img-fotki.yandex.ru/get/165720/158289418.406/0_178867_d1ff26b5_orig.png

Развернуто: https://img-fotki.yandex.ru/get/167717/ … d_orig.png

Фрагмент:

https://img-fotki.yandex.ru/get/249078/158289418.406/0_178868_6ae8c6fc_orig.png
Этот фрагмент собирается в темпе вальса. В смысле в темпе коллагена smile
См. полный комплект файлов: https://cloud.mail.ru/public/5S1m/okiNUfhhx

https://img-fotki.yandex.ru/get/229553/158289418.406/0_178869_786c1239_orig.png

https://img-fotki.yandex.ru/get/225029/158289418.406/0_17886a_82ea4a62_orig.png

https://img-fotki.yandex.ru/get/59977/158289418.406/0_17886b_cf6e7d5b_orig.png

https://img-fotki.yandex.ru/get/230858/158289418.406/0_17886c_a323f9d6_orig.png

https://img-fotki.yandex.ru/get/230858/158289418.406/0_17886d_749c7d93_orig.png

Точнее всего скорее модель с величиной угла 30 градусов.




https://www.ncbi.nlm.nih.gov/protein/11 … NZ5DF0H014

https://www.ncbi.nlm.nih.gov/nuccore/1127494923

>ENA|OLL84536|complement 408 nucleotides
gtgccacccgtccagccacccgggttcagcgagttggtgcacgccccgacccggctgtcg
ctgctgtcgctgctctcggccaccgaccggatcgagttcgggctgcttcgcgacggcctg
gcgctgtcggactcggccttgtccaagcagctgggcatcctggaggaggccgggctggtg
gcgttggagcgcgacggtgtggggcgcgggaagcgggtgcgtgtgcgcatgaccgacagt
ggtcggcggaccttcgacgaccacgtcgccgcgctgcaggtcatcgtgcgccgcggcgcc
cccggcgcccccggcgcccccggcgcccccggcgcccccggcgcccccggcgcccccggc
gcccccggcgcccccggcgctccctcgcagtccacgtccgcgagctga

https://img-fotki.yandex.ru/get/218038/158289418.406/0_17886f_b26ad3cc_orig.png

Развернуто: https://img-fotki.yandex.ru/get/118251/ … 3_orig.png

https://img-fotki.yandex.ru/get/218038/158289418.406/0_178870_cb6be9a0_orig.png

https://img-fotki.yandex.ru/get/28561/158289418.406/0_178871_e451602c_orig.png

Точнее, вероятно, с углом 30, но нужно уточнять дальше, причём все композиционные углы.






Белок KR2. Оптогенетика. Лаборатория перспективных исследований мембранных белков МФТИ. Структура KR2 по Пикотехнологии Кушелева. Для авторов: Георг Бюлдт (Georg Bueldt) , Валентин Горделий, Валентин Борщевский, Вадим Черезов, Иван Гущин

Татьяна Рясина пишет:

По поиску    -    структура белка KR2 - находится

https://www.google.ru/search?q=%D0%B1%D … %D0%B0+KR2

Кушелев:

На уровне вторичной структуры очевидно, что нет там альфа-спиралей, заявленных в PDB.



Формы, механизмы, энергия наномира. Сообщение 83 791

Татьяна Рясина пишет:

Универсальный «переключатель» для светочувствительных клеток
https://mipt.ru/newsblog/lenta/versatil … lled_cells

"Кристаллическая структура натриевого насоса"



Кушелев:

Под данным РСА - сплошные альфа-спирали, а программа Пикотех показывает пи-спирали и программные спирали. Во всей структуре попался только один виток альфа-спирали и 4 одиночных витка 310-спирали smile




https://img-fotki.yandex.ru/get/198017/158289418.3b0/0_16f268_35bc526f_XL.jpg


Кушелев:

Понятно. Четвертичную структуру с пятеричной симметрией разглядели, а третичную структуру заполнили альфа-спиралями, которых в этом белке нет. Надо будет построить 3D модель, когда ошибки в 3D-версии Пикотех будут исправлены.


http://www.rcsb.org/pdb/explore/explore … ureId=4XTN

http://www.uniprot.org/uniprot/N0DKS8

http://www.ebi.ac.uk/ena/data/view/BAN14808

>ENA|BAN14808|BAN14808.1 Dokdonia eikasta sodium pumping rhodopsin
ATGACACAAGAACTAGGGAATGCCAATTTCGAAAATTTCATTGGAGCTACAGAAGGATTT
TCTGAAATTGCTTATCAATTTACATCACATATCCTTACGTTAGGGTACGCAGTGATGCTT
GCAGGATTACTATACTTTATCCTTACCATCAAAAATGTAGATAAAAAATTCCAAATGTCG
AACATATTATCAGCTGTGGTAATGGTATCGGCATTTTTGCTATTATATGCGCAGGCACAA
AACTGGACATCCAGTTTTACCTTTAATGAAGAAGTAGGAAGATATTTTTTAGATCCGAGT
GGTGATCTATTTAATAACGGATATCGCTATCTTAACTGGCTCATCGATGTACCTATGCTT
CTCTTTCAAATTCTATTTGTAGTAAGTTTAACTACTTCAAAATTTAGCTCTGTACGTAAC
CAATTCTGGTTTTCTGGGGCAATGATGATTATTACTGGGTACATTGGACAGTTTTATGAG
GTAAGTAACTTGACTGCCTTTTTAGTATGGGGAGCTATTTCATCTGCTTTTTTCTTCCAT
ATTTTATGGGTTATGAAGAAGGTAATTAATGAAGGAAAAGAGGGGATTTCCCCAGCAGGA
CAAAAAATACTTTCTAATATCTGGATCTTATTTTTAATATCATGGACTTTATATCCAGGA
GCTTACTTAATGCCATACCTTACTGGAGTAGACGGATTTTTATATAGTGAAGATGGCGTG
ATGGCTAGACAACTAGTATACACTATTGCAGATGTAAGTTCTAAAGTTATCTATGGTGTA
TTATTAGGTAACCTAGCAATTACATTAAGTAAAAACAAAGAGTTGGTTGAAGCAAATAGC
TAA




Проект он-лайн сервиса "Структура белков по нуклеотидной последовательности"




Алгоритм построения 3D структур требует уточнения композиционных углов

Таблица митохондриального генетического кода и углы поворота белковых спиралей

Кодируется ли тип спиралей белков композиционным генетическим кодом? Точность и стоимость РСА. Самоповерка пикотехнологии.

Январь 2017. Кушелевские структемы генетического кода белкового мира и мультикомпозиционный код




[20:12:40] Andrei: в чем открытие?
[20:12:49] Andrei: комбинация кодонов?
[20:17:14] Кушелев Александр Юрьевич: Открытие заключается в том, что три буквы кодируют не только аминокислоту, но и угол поворота этой аминокислоты относительно предыдущей:

http://nanoworld88.narod.ru/data/216_files/bio.gif

[20:17:59] Кушелев Александр Юрьевич: Этот угол (и формы аминокислот) как раз и открывают возможность определять структуры белков по таблице
[20:18:08] Andrei: а что не знали что углы есть?
[20:18:17] Кушелев Александр Юрьевич: Знали
[20:18:23] Кушелев Александр Юрьевич: Но не знали, что эти углы кодируются




Татьяна Рясина пишет:

Александр Юрьевич, сделайте пожалуйста, если будет возможность структуру белка KR2 в старой версии Пикотеха - пятиконечную структуру с молекулами и вариант кольцегранной молекулы с вращением.

Кушелев:

Тот белок не так прост. Его в старой версии не сделать.




Формы, механизмы, энергия наномира. Сообщение 86 978

Пикотехнология белков, ДНК, РНК - 2

Татьяна Рясина пишет:

Пикотехнология тоже, как и РСА, показывает этот самый натриевый насос в белке KR2, и если да, то как?

Кушелев:

Для ответа на этот вопрос нужно исправить ошибки, т.е построить правильную 3D-модель этой белковой молекулы. Для этого нужна интерактивная версия программы Пикотех, которая уже запланирована, но будет создана не очень скоро. Программист сильно занят зарабатывание денег на жизнь, поэтому программами может заниматься раз в неделю по полчаса. Такими темпами можно год и больше писать интерактивную версию Пикотех-3D.



Татьяна Рясина пишет:

Вы могли бы сделать 3D , 4D структуру белка KR2 на обновлённой версии Пикотеха?

Кушелев: Так новая версия ещё не готова. Программист сильно занят. Пока нашёл время только на усовершенствование 2D-версии.

Но даже на этом уровне хорошо видно, что РСА не "видит" даже вторичную структуру белка. Поэтому исследователи заполняют её кусками альфа-спиралей "от фонаря" smile

А реальная структура совсем другая.

http://nanoworld.org.ru/post/81583/#p81583
Я конечно, могу запустить определение третичной структуры на старой версии Пикотех, но может быть много ошибок. Запускать?



Татьяна Рясина пишет:

А самые новые апрельские структуры Вы в старой версии делаете?
Чисто житейски лучше конечно подождать версию без ошибок.
А потом выслать профессуре МФТИ.

Кушелев:

Да, пока в старой. Для спиральных участков это обычно "прокатывает", но тоже не всегда. Программные спирали бывают разные...



Татьяна Рясина пишет:

Но конечно хочется в старой версии увидеть тоже ))))

Кушелев: Сейчас попробую сделать



>ENA|BAN14808|BAN14808.1 Dokdonia eikasta sodium pumping rhodopsin
ATGACACAAGAACTAGGGAATGCCAATTTCGAAAATTTCATTGGAGCTACAGAAGGATTT
TCTGAAATTGCTTATCAATTTACATCACATATCCTTACGTTAGGGTACGCAGTGATGCTT
GCAGGATTACTATACTTTATCCTTACCATCAAAAATGTAGATAAAAAATTCCAAATGTCG
AACATATTATCAGCTGTGGTAATGGTATCGGCATTTTTGCTATTATATGCGCAGGCACAA
AACTGGACATCCAGTTTTACCTTTAATGAAGAAGTAGGAAGATATTTTTTAGATCCGAGT
GGTGATCTATTTAATAACGGATATCGCTATCTTAACTGGCTCATCGATGTACCTATGCTT
CTCTTTCAAATTCTATTTGTAGTAAGTTTAACTACTTCAAAATTTAGCTCTGTACGTAAC
CAATTCTGGTTTTCTGGGGCAATGATGATTATTACTGGGTACATTGGACAGTTTTATGAG
GTAAGTAACTTGACTGCCTTTTTAGTATGGGGAGCTATTTCATCTGCTTTTTTCTTCCAT
ATTTTATGGGTTATGAAGAAGGTAATTAATGAAGGAAAAGAGGGGATTTCCCCAGCAGGA
CAAAAAATACTTTCTAATATCTGGATCTTATTTTTAATATCATGGACTTTATATCCAGGA
GCTTACTTAATGCCATACCTTACTGGAGTAGACGGATTTTTATATAGTGAAGATGGCGTG
ATGGCTAGACAACTAGTATACACTATTGCAGATGTAAGTTCTAAAGTTATCTATGGTGTA
TTATTAGGTAACCTAGCAATTACATTAAGTAAAAACAAAGAGTTGGTTGAAGCAAATAGC
TAA

https://img-fotki.yandex.ru/get/27836/158289418.3b0/0_16f26a_f1ef536d_XL.png


Под данным РСА - сплошные альфа-спирали, а программа Пикотех показывает пи-спирали и программные спирали. Во всей структуре попался только один виток альфа-спирали и 4 одиночных витка 310-спирали smile


https://img-fotki.yandex.ru/get/198488/158289418.3b0/0_16f26b_484559f3_orig.gif


https://img-fotki.yandex.ru/get/198361/158289418.3f3/0_177918_892fa641_orig.png

https://img-fotki.yandex.ru/get/195195/158289418.3f3/0_177919_93e10d8a_orig.png

https://img-fotki.yandex.ru/get/197756/158289418.3f3/0_177917_822c3402_orig.png





3D структуры март-апрель 2017. Проект он-лайн сервиса структур белков по нуклеотидной последовательности



Проект Пикотехнология Белков Оналйн


                                                                                                                                              

Пикотехнология белков, ДНК, РНК. Часть 1

Пикотехнология белков, ДНК, РНК. Часть 2   

Пикотехнология белков, ДНК, РНК. Часть  3




Кодируется ли тип спиралей белков композиционным генетическим кодом?

Точность и стоимость РСА (рентгено-структурного анализа).

Самоповерка пикотехнологии.



Формы, механизмы, энергия наномира. Сообщение 86 504

Пикотехнология белков, ДНК, РНК - 2

Skype:

[22.03.2017 18:49:44] Кушелев Александр Юрьевич: А список меню постепенно растёт...
1. 2D-структура в новом формате.
2. Файл в стандарте MIDI
3. Компактный файл fasta (с отработанными Join и Complement)
4. Компактный файл dne/embl (только идентификатор белка и входной код. С простым CDS 1..n)
5. 2D-структура в старом формате (как сейчас) с разбивкой по 1000 строк. 
6. Композиционный код-6
7. Композиционный код-4

 Также в меню добавляется  компактная запись вторичной структуры белка

 Раскрашивание триплетов по алгоритму вторичной структуры экономит время.


Код-6 получается из кода 4 по дополнительному простому алгоритму. Но проблема заключается в том, что в программе-скрипте, которую написал Денис Савин, зарезервировано меньше вариантов композиций, чем нужно для реализации кода-6

А доделывать эту Версию Валентин считает неправильным. Он хочет сделать правильную версию на другом языке. Ждём-С



Формы, механизмы, энергия наномира. Сообщение 86 878

Пикотехнология белков, ДНК, РНК - 2

Татьяна Рясина пишет:

Как кратко пояснить, зачем нужен сайт с готовыми моделями? Люди вообще слышат и видят в первый раз в жизни.

Кушелев:

Ежедневно на нашей планете кто-то оплачивает не менее 30 заказов по структурам белковых молекул. Это видно по увеличению количества белков в Protein Data Base (PDB). За каждую структуру платят в среднем 10 000 евро и ждут от нескольких недель до нескольких лет.

Структуры нужны фармацевтам, биотехнологам, генным инженерам. Потенциальных заказчиков можно найти по ключевым словам protein, nanotech



https://img-fotki.yandex.ru/get/30536/158289418.3f0/0_177790_20c09ef8_orig.png

https://img-fotki.yandex.ru/get/61164/158289418.3f0/0_177791_b040673f_orig.png

https://img-fotki.yandex.ru/get/102548/158289418.3f0/0_177792_945c6af6_orig.png

https://img-fotki.yandex.ru/get/102548/158289418.3f0/0_177793_f54bab17_orig.png

https://img-fotki.yandex.ru/get/199051/158289418.3f0/0_177794_94fd2306_orig.png

https://img-fotki.yandex.ru/get/404236/158289418.3f0/0_177795_6961e838_XL.png


Развёрнуто: https://img-fotki.yandex.ru/get/205820/ … a_orig.png



Формы, механизмы, энергия наномира. Сообщение 87 086

Пикотехнология белков, ДНК, РНК - 2

Открыта программная трехлопастная 323321321-белковая спираль

Кушелев: А теперь давайте посмотрим, не найдутся ли комплементарные ноты Лунной сонаты?

Вместо n(QNT) нужно найти n(TNQ)

https://blast.ncbi.nlm.nih.gov

Итак, ищем TNQTNQTNQTNQTNQTNQTNQTNQTNQTNQTNQTNQTNQ

https://www.ncbi.nlm.nih.gov/protein/56 … TJUM2XZ016

https://www.ncbi.nlm.nih.gov/nuccore/564280748


Вообще-то это не комплементарное преобразование, а фрактальный реверс, но ... тоже интересно!


Разметка триплетов

https://img-fotki.yandex.ru/get/174613/158289418.3f6/0_177d89_50965d5e_orig.png


Вид вдоль оси симметрии. Примерно 8.5 аминокислотных остатков на виток.

https://img-fotki.yandex.ru/get/233608/158289418.3f6/0_177d44_5e7845ae_orig.pnghttps://img-fotki.yandex.ru/get/225029/158289418.3f6/0_177d42_a8059090_orig.png
https://img-fotki.yandex.ru/get/198361/158289418.3f6/0_177d43_f74d2081_orig.png
Так выглядит 233-спираль (7 витков, 60 аминокислотных остатков)

Это, как и 35-спираль (Q-спираль) может быть пикотехнологическим реактором. Только меньшего диаметра (раза в полтора) и соответственно большего давления (раза в два).

https://img-fotki.yandex.ru/get/233044/158289418.3f6/0_177d40_51982051_orig.gif

Программная 233-спираль переходит в очень необычную трёхлопостную программную спираль.

https://img-fotki.yandex.ru/get/218579/158289418.3f6/0_177d3d_69bf9721_orig.png


Циклическое повторение 30 аминокислотных остатков соответствует такой структуре.

https://img-fotki.yandex.ru/get/225029/158289418.3f6/0_177d3f_1aafb705_orig.png
Циклическое повторение 30 аминокислотных остатков соответствует такой структуре.


https://img-fotki.yandex.ru/get/196142/158289418.3f6/0_177d8c_c3724a62_orig.pnghttps://img-fotki.yandex.ru/get/194858/158289418.3f6/0_177d8d_76b47271_orig.png 

"Красота форм в природе" smile      Атомы изображены шариками


https://img-fotki.yandex.ru/get/244154/158289418.3f6/0_177d8e_f39bd714_orig.pnghttps://img-fotki.yandex.ru/get/93917/158289418.3f6/0_177d92_deea5300_orig.png
Межатомные связи изображены трубками.  Электронные оболочки изображены точками


https://img-fotki.yandex.ru/get/195648/158289418.3f6/0_177d93_f3f55237_orig.pnghttps://img-fotki.yandex.ru/get/99813/158289418.3f6/0_177d94_30f83753_orig.png

https://img-fotki.yandex.ru/get/366459/158289418.3f7/0_177d97_99223f91_orig.png

https://img-fotki.yandex.ru/get/171919/158289418.3f7/0_177d9a_b05e6f03_orig.pnghttps://img-fotki.yandex.ru/get/362774/158289418.3f7/0_177d9c_fdd9128c_orig.pnghttps://img-fotki.yandex.ru/get/196161/158289418.3f7/0_177d9f_dd6ee792_orig.pnghttps://img-fotki.yandex.ru/get/225029/158289418.3f7/0_177d9e_8804aa3b_orig.png

https://img-fotki.yandex.ru/get/196548/158289418.3f7/0_177da1_be116ab9_orig.pnghttps://img-fotki.yandex.ru/get/171919/158289418.3f7/0_177da2_c91be39a_orig.png
Такая необычная трехлопастная программная спираль встречается в белковых молекулах...




Формы, механизмы, энергия наномира. Сообщение 87 115

Пикотехнология белков, ДНК, РНК - 2

https://img-fotki.yandex.ru/get/108697/158289418.3f9/0_177f3f_687e9332_L.png

IN(L,D)NINNINNV

https://blast.ncbi.nlm.nih.gov

http://molbiol.ru/scripts/01_12.html

https://www.ncbi.nlm.nih.gov/protein/11 … ZFCTC45013

https://www.ncbi.nlm.nih.gov/nuccore/1103666979

CRG93487


https://img-fotki.yandex.ru/get/468374/158289418.3fa/0_178033_caa68dc6_orig.png

https://img-fotki.yandex.ru/get/218579/158289418.3fa/0_178038_98f318c7_orig.png

https://img-fotki.yandex.ru/get/196060/158289418.3fa/0_178039_10f1ca8c_orig.png

https://img-fotki.yandex.ru/get/172931/158289418.3fa/0_17803b_1ffa431a_orig.png

https://img-fotki.yandex.ru/get/57422/158289418.3fa/0_17803c_9aeaeb47_orig.png

https://img-fotki.yandex.ru/get/218579/158289418.3fa/0_17803d_d5713dbd_orig.png

https://img-fotki.yandex.ru/get/55431/158289418.3fa/0_17803e_5ce019c8_orig.png

По нотам 40-ой симфонии Моцарта нашлась ... треугольная спираль!

Однако музыку Моцарта, которая звучит при сборке этого белка мы пока не услышим. Белок слишком крупный для того, чтобы программа могла обработать его целиком. Нужно найти этот фрагмент.

https://img-fotki.yandex.ru/get/148218/158289418.3fa/0_1780c2_58d06d8a_orig.png

https://img-fotki.yandex.ru/get/246155/158289418.3fa/0_1780c7_b14477fe_orig.png

https://img-fotki.yandex.ru/get/217607/158289418.3fa/0_1780c8_313af073_orig.png

https://img-fotki.yandex.ru/get/198786/158289418.3fa/0_1780c9_539ecb2e_orig.png

https://img-fotki.yandex.ru/get/26144/158289418.3fb/0_17810c_70babda3_orig.png
Музыка сборки этого фрагмента (10 нот) совпадают с началом 40-ой симфонии Моцарта.





Формы, механизмы, энергия наномира. Сообщение 87 117

Пикотехнология белков, ДНК, РНК - 2

https://www.ncbi.nlm.nih.gov/protein/12 … TJUM2XZ016

https://www.ncbi.nlm.nih.gov/nuccore/124805469

>ENA|XP_001350449| 3270 nucleotides

https://img-fotki.yandex.ru/get/227342/158289418.3fa/0_178025_a5db014f_orig.png

https://img-fotki.yandex.ru/get/233608/158289418.3fa/0_178029_bb3834dd_orig.png
Похоже, что дисульфидный мостик Cys17-Cys28 должен замкнуться.

https://img-fotki.yandex.ru/get/195786/158289418.3fa/0_17802a_9a14ccf4_orig.png

https://img-fotki.yandex.ru/get/216915/158289418.3fa/0_17802b_df05631f_orig.png

https://img-fotki.yandex.ru/get/249782/158289418.3fa/0_17802e_df8a2971_orig.png
Напластование "восьмёрок", как в белке EWC87459, и цикл, который через них замыкается.




https://www.ncbi.nlm.nih.gov/protein/25 … TJUM2XZ016

https://www.ncbi.nlm.nih.gov/nuccore/258596982

>ENA|XP_001347352|1152 nucleotides

https://img-fotki.yandex.ru/get/246231/158289418.3f7/0_177e25_ca37a4c1_orig.png

https://img-fotki.yandex.ru/get/171919/158289418.3f7/0_177e27_a0edf363_orig.gif

Конец белковой молекулы соединяется с началом фрагмента через дисульфидный мостик.

https://img-fotki.yandex.ru/get/107473/158289418.3f7/0_177e2a_7994a7b_orig.png

https://img-fotki.yandex.ru/get/194835/158289418.3f7/0_177e2b_26a32b4_orig.png

https://img-fotki.yandex.ru/get/107473/158289418.3f7/0_177e2c_5c323044_orig.png

https://img-fotki.yandex.ru/get/195990/158289418.3f7/0_177e2f_c3c1829a_orig.png

Конечно, за 7 десятков композиций накапливается ошибка, ведь алгоритм не учитывает физико-химические взаимодействия. Тем не менее очевидно, что речь идёт о циклическом фрагменте из 72 (семидесяти двух!) аминокислотных остатков.

https://img-fotki.yandex.ru/get/235925/158289418.3f7/0_177e32_dcf53bb5_orig.png

https://img-fotki.yandex.ru/get/195195/158289418.3f7/0_177e33_41568203_orig.png

https://img-fotki.yandex.ru/get/54787/158289418.3f7/0_177e34_b6bb70ef_orig.png

https://img-fotki.yandex.ru/get/94189/158289418.3f7/0_177e36_cd91f47_orig.png

https://img-fotki.yandex.ru/get/177849/158289418.3f7/0_177e37_f1f28629_orig.png

Этот фрагмент состоит из элементов программной трёхлопастной спирали.

Подробнее: http://nanoworld.org.ru/topic/297/page/98/




Формы, механизмы, энергия наномира. Сообщение 87 116

Пикотехнология белков, ДНК, РНК - 2

https://www.ncbi.nlm.nih.gov/protein/64 … ZFCTC45013

https://www.ncbi.nlm.nih.gov/nuccore/641579244

>ENA|CDO66378|11550 nucleotides

https://img-fotki.yandex.ru/get/120725/158289418.3fb/0_1780f5_fcf4d7ca_orig.png

https://img-fotki.yandex.ru/get/96803/158289418.3fb/0_1780f6_9795c966_orig.png

https://img-fotki.yandex.ru/get/51236/158289418.3fb/0_1780f8_ad4191a7_orig.png

https://img-fotki.yandex.ru/get/206909/158289418.3fb/0_1780f9_4b26f3a2_orig.png

https://img-fotki.yandex.ru/get/31027/158289418.3fb/0_1780fa_8cd04305_orig.png

https://img-fotki.yandex.ru/get/196183/158289418.3fb/0_1780fb_b70c94f3_orig.png

https://img-fotki.yandex.ru/get/225029/158289418.3fb/0_1780fe_c417534a_orig.png

https://img-fotki.yandex.ru/get/53078/158289418.3fb/0_1780ff_d127a054_orig.png

https://img-fotki.yandex.ru/get/174613/158289418.3fb/0_178102_d48532e4_orig.png

https://img-fotki.yandex.ru/get/198017/158289418.3fb/0_178103_3fa66df7_orig.png

https://img-fotki.yandex.ru/get/174613/158289418.3fb/0_178107_b88b0472_orig.png

https://img-fotki.yandex.ru/get/104700/158289418.3fb/0_178108_9d57caad_orig.png

https://img-fotki.yandex.ru/get/6712/158289418.3fb/0_178109_2c0e67bb_orig.png

https://img-fotki.yandex.ru/get/225650/158289418.3fb/0_17810a_73c7fc65_orig.png

https://img-fotki.yandex.ru/get/99813/158289418.3fb/0_17810b_e8292a39_orig.png
Музыка сборки этого фрагмента белковой молекулы




Пикотехнология белков, ДНК, РНК - 2

https://www.ncbi.nlm.nih.gov/protein/59 … PG4YMDD013

https://www.ncbi.nlm.nih.gov/nuccore/597849141

Кушелев: Забавная программная 34443555-спираль. Интересно будет посмотреть 3D модель...

https://img-fotki.yandex.ru/get/196102/158289418.3f6/0_177cef_7471db00_orig.png

https://img-fotki.yandex.ru/get/197741/158289418.3f6/0_177cec_9dc62a4_orig.png

https://img-fotki.yandex.ru/get/113457/158289418.3f6/0_177ced_9fd71fde_orig.png

https://img-fotki.yandex.ru/get/216915/158289418.3f6/0_177cee_3d73bd_orig.png

https://img-fotki.yandex.ru/get/229651/158289418.3f6/0_177cf2_725b4fcc_orig.png

https://img-fotki.yandex.ru/get/249479/158289418.3f6/0_177cf3_fbbcaac3_orig.png
К сожалению, код "5" в существующей 3D-версии Пикотех ещё отрабатывается не корректно. Поэтому мы пока не узнаем реальную форму программной 34443555-спирали. Фактически мы видим форму 3111-спирали. Она имеет ось симметрии 7-го порядка.

https://img-fotki.yandex.ru/get/224193/158289418.3f6/0_177cf4_2385bf4_orig.png

https://img-fotki.yandex.ru/get/195132/158289418.3f6/0_177cf6_393ad529_orig.png

https://img-fotki.yandex.ru/get/195518/158289418.3f6/0_177cf7_2de2700d_orig.png

https://img-fotki.yandex.ru/get/247911/158289418.3f6/0_177cf8_53cfeb03_orig.png

Корректная отработка кода "5" должна привести к деформации 34443555-спирали. Но это мы сможем увидеть в будущем, когда будет доделана следующая версия программы Пикотех-3D.



Формы, механизмы, энергия наномира. Сообщение 87 104

Пикотехнология белков, ДНК, РНК - 2

https://www.ncbi.nlm.nih.gov/protein/91 … TJUM2XZ016

https://www.ncbi.nlm.nih.gov/nuccore/226466085

https://img-fotki.yandex.ru/get/227342/158289418.3f9/0_177f0d_5e81eb9e_orig.png

https://img-fotki.yandex.ru/get/61164/158289418.3f9/0_177f0e_427088f6_orig.png
Понятно, что треугольник из пи-спиралей должен замкнуться.

https://img-fotki.yandex.ru/get/94189/158289418.3f9/0_177f10_2efd002b_orig.png
В модели он почти замкнут. Это понятно, ведь алгоритм чисто геометрический. Не учитывает физико-химические взаимодействия.

https://img-fotki.yandex.ru/get/237815/158289418.3f9/0_177f11_63f432ba_orig.png
Углы пи-спирали, вероятно, настроены неточно.

https://img-fotki.yandex.ru/get/197756/158289418.3f9/0_177f12_cbdabc4d_orig.png
Как уже было замечено ранее, самое сложное в моделировании - переходы с одного типа спирали на другую.

https://img-fotki.yandex.ru/get/228174/158289418.3f9/0_177f13_2ae5259b_orig.png
Именно в области перехода с одной спирали на другую погрешности углов сказываются сильнее всего. Тем не менее, накопившаяся за 70 аминокислотных остатков ошибка порядка 10 диаметров атома углерода. Это значит, что в пересчёте на один аминокислотный остаток погрешность не превышает 10/70=13% от размера атома.

https://img-fotki.yandex.ru/get/229553/158289418.3f9/0_177f35_16a600b8_orig.gif



https://www.ncbi.nlm.nih.gov/protein/58 … TJUM2XZ016

https://www.ncbi.nlm.nih.gov/nuccore/508695481

https://img-fotki.yandex.ru/get/197756/158289418.3fa/0_177f4e_78889396_orig.gif

https://img-fotki.yandex.ru/get/30752/158289418.3f9/0_177f52_5e510a54_orig.png

https://img-fotki.yandex.ru/get/249078/158289418.3f9/0_177f53_2260bf9d_orig.png

https://img-fotki.yandex.ru/get/114758/158289418.3f9/0_177f55_f273cbf5_orig.png


https://img-fotki.yandex.ru/get/233608/158289418.3fa/0_177f58_af320d6_orig.png

https://img-fotki.yandex.ru/get/194835/158289418.3fa/0_177f59_3c347406_orig.png

https://img-fotki.yandex.ru/get/194835/158289418.3fa/0_177f5c_b5939706_orig.png

https://img-fotki.yandex.ru/get/242441/158289418.3fa/0_177f5d_11934a22_orig.png



Формы, механизмы, энергия наномира. Сообщение 87 120

Пикотехнология белков, ДНК, РНК - 2

Белковая спираль Моцарта-Кушелева


https://img-fotki.yandex.ru/get/25939/158289418.3fc/0_178174_314dcbb0_orig.png

IDDIDDIDDV

https://www.ncbi.nlm.nih.gov/protein/25 … ZJ2D64R013

https://www.ncbi.nlm.nih.gov/nuccore/255722494



https://img-fotki.yandex.ru/get/197741/158289418.3fb/0_178163_2a74bcaa_orig.png



https://img-fotki.yandex.ru/get/48807/158289418.3fb/0_178166_150beb15_orig.png

https://img-fotki.yandex.ru/get/42692/158289418.3fb/0_178167_9b250c9f_orig.png

https://img-fotki.yandex.ru/get/169451/158289418.3fb/0_178168_3b1d40fb_orig.png

https://img-fotki.yandex.ru/get/194588/158289418.3fb/0_178169_7b0e1347_orig.png

https://img-fotki.yandex.ru/get/196121/158289418.3fb/0_17816a_c2980d29_orig.png

https://img-fotki.yandex.ru/get/196365/158289418.3fb/0_17816b_be2c5015_orig.png

https://img-fotki.yandex.ru/get/42692/158289418.3fb/0_17816c_74555147_orig.png

https://img-fotki.yandex.ru/get/55195/158289418.3fc/0_17816d_c353bddb_orig.png

https://img-fotki.yandex.ru/get/231315/158289418.3fc/0_17816e_c436c3fc_orig.png

https://img-fotki.yandex.ru/get/56796/158289418.3fc/0_17816f_ecb4dce5_orig.png

https://img-fotki.yandex.ru/get/231315/158289418.3fc/0_178171_9dc735f8_orig.png
Спираль Моцарта-Кушелева (533-спираль) интересна тем, что на один виток приходится почти 14 аминокислотных остатков. При этом спираль имеет ось симметрии ~5 порядка.

Любопытно и то, что композиционный код сдвинут относительно музыкального (и первичной последовательности), т.е. разным нотам соответствует одинаковая композиция соседних аминокислотных остатков и в то же время разные углы поворота соответствуют одинаковым нотам. Более того, третья нота, как и в 40-ой симфонии Моцарта звучит вдвое дольше второй!

https://img-fotki.yandex.ru/get/479589/158289418.3fc/0_178175_12f1e36b_orig.png
Это связано с тем, что вторая нота соответствует коду альфа-спирали, когда нет вращения транспортной РНК, а третья нота соответствует коду пи-спирали, когда тратится время на дополнительное вращение тРНК.



Формы, механизмы, энергия наномира. Сообщение 86 835

Пикотехнология белков, ДНК, РНК - 2

Онлайн сервис "Структура белка по нуклеотидной последовательности"

Кушелев: Здравствуйте, уважаемые коллеги!
Предлагаю расширить Ваш сервис, дополнив его демонстрацией вторичной структуры белка по нуклеотидной последовательности и другими .  Подробности: http://nanoworld.org.ru/topic/1653/

С уважением,
Руководитель лаборатории Наномир,
Александр Кушелев



https://img-fotki.yandex.ru/get/194588/158289418.3eb/0_1773f0_a0e02a4f_orig.png

https://img-fotki.yandex.ru/get/176508/158289418.3eb/0_1773f3_9993c661_orig.png

https://img-fotki.yandex.ru/get/195786/158289418.3eb/0_1773f4_cc38541_orig.png




https://img-fotki.yandex.ru/get/198488/158289418.3eb/0_1773fe_3c0cb47a_orig.png

https://img-fotki.yandex.ru/get/196142/158289418.3eb/0_1773ff_bfe32618_orig.png




https://img-fotki.yandex.ru/get/107080/158289418.3ea/0_1772e0_35f2af04_orig.png

https://img-fotki.yandex.ru/get/42692/158289418.3ea/0_1772e1_1154d43_orig.png


Пикотехнологические реакторы с внутренними и внешними конвейерами

https://img-fotki.yandex.ru/get/152444/158289418.3e9/0_17720a_f2f0d072_orig.png

https://img-fotki.yandex.ru/get/51236/158289418.3e9/0_17720b_846e943a_orig.png



https://img-fotki.yandex.ru/get/176331/158289418.3ea/0_1772f1_ca84f3cf_XL.png

https://img-fotki.yandex.ru/get/174613/158289418.3eb/0_177307_5190645a_orig.gif

https://img-fotki.yandex.ru/get/228104/158289418.3eb/0_177353_87f3465b_orig.gif

https://img-fotki.yandex.ru/get/143523/158289418.3ed/0_177457_97fe24e1_orig.png

https://img-fotki.yandex.ru/get/168237/158289418.3ed/0_177458_3b4dadbf_orig.png

https://img-fotki.yandex.ru/get/166616/158289418.3ed/0_177459_6898e8d2_orig.png


https://img-fotki.yandex.ru/get/195431/158289418.3ed/0_177452_9698d0d6_orig.gif


https://img-fotki.yandex.ru/get/94596/158289418.3ed/0_17744e_a1bc987d_orig.png

https://img-fotki.yandex.ru/get/218579/158289418.3ed/0_17744f_ade38994_orig.png

https://img-fotki.yandex.ru/get/196258/158289418.3ed/0_177451_c2e23eca_orig.png

https://img-fotki.yandex.ru/get/114207/158289418.3ed/0_17744d_37ee9227_orig.gif

Структура белка определена правильно

https://img-fotki.yandex.ru/get/94596/158289418.3ef/0_177648_87e9f9a2_orig.png
Равнобедренный пятиугольник!

https://img-fotki.yandex.ru/get/366459/158289418.3ef/0_177649_bba16b25_orig.png

https://img-fotki.yandex.ru/get/225029/158289418.3ef/0_17764a_e2690627_orig.png


https://img-fotki.yandex.ru/get/54787/158289418.3ef/0_177645_5727d316_orig.gif



https://img-fotki.yandex.ru/get/173114/158289418.3ef/0_17768b_821d013d_orig.png

https://img-fotki.yandex.ru/get/104083/158289418.3ef/0_177666_c92d708e_orig.gif

https://img-fotki.yandex.ru/get/237726/158289418.3ef/0_177669_da5b48d9_orig.gif



Длина прямого альфа-спирального участка достигает 737-322+1=416 аминокислотных остатков. Вероятность случайного кода = 4^-415=10^-250

https://img-fotki.yandex.ru/get/54522/158289418.3f0/0_1776af_40b8f715_orig.png

https://img-fotki.yandex.ru/get/199051/158289418.3f0/0_1776b3_701396fa_orig.png


https://img-fotki.yandex.ru/get/197923/158289418.3ef/0_17769f_f1c221a_orig.png

https://img-fotki.yandex.ru/get/197923/158289418.3ef/0_1776a0_5e52def9_orig.png

https://img-fotki.yandex.ru/get/195990/158289418.3ef/0_1776a1_5c9f6229_orig.png

https://img-fotki.yandex.ru/get/106693/158289418.3ef/0_1776a2_2baefa49_orig.png


Каждая "загогулина" NQQFQV является мета-элементом пико-конструктора.

В отличие от аминокислот мета-элементы складываются в параллелепипеды, т.е. программирование идёт как бы на уровне кубиков с прямыми углами. Хотя ... может показалось, что углы прямые.

https://img-fotki.yandex.ru/get/243369/158289418.3e6/0_176ec8_a6567e_XL.png

https://img-fotki.yandex.ru/get/59613/158289418.3e6/0_176ecb_597bbb1e_XL.png


https://img-fotki.yandex.ru/get/244791/158289418.3e3/0_176b54_7b8ee6c7_XL.png

https://img-fotki.yandex.ru/get/93500/158289418.3e3/0_176b55_4f0dcfaf_XL.png



Q-спираль по существу является реактором, состоящим из атомов азота...

https://img-fotki.yandex.ru/get/226123/158289418.3e4/0_176d07_db0043b_XL.png

https://img-fotki.yandex.ru/get/30536/158289418.3e4/0_176d06_aae8cb52_orig.gif


https://img-fotki.yandex.ru/get/196365/158289418.3e4/0_176d08_a81c1ffb_XL.png


https://img-fotki.yandex.ru/get/195431/158289418.3e4/0_176d09_d60bc7c5_XL.png

https://img-fotki.yandex.ru/get/169883/158289418.3e4/0_176d0a_12fe5ea6_XL.png

https://img-fotki.yandex.ru/get/57797/158289418.3e4/0_176d0c_8a39a920_XL.png


https://img-fotki.yandex.ru/get/196183/158289418.3e4/0_176d0f_119a0535_XL.png

https://img-fotki.yandex.ru/get/52790/158289418.3e4/0_176d0b_1e8c03ad_XL.png

https://img-fotki.yandex.ru/get/30894/158289418.3e4/0_176d10_7aef9c77_XL.png

https://img-fotki.yandex.ru/get/246231/158289418.3e4/0_176d11_685d4236_XL.png



https://img-fotki.yandex.ru/get/109878/158289418.3e4/0_176dc1_ef9cfd1d_XL.png

https://img-fotki.yandex.ru/get/9116/158289418.3e4/0_176dc2_ba7df904_XL.png

https://img-fotki.yandex.ru/get/197807/158289418.3e4/0_176dc3_a58ff018_XL.png

https://img-fotki.yandex.ru/get/105284/158289418.3e4/0_176dc4_b6415408_XL.png

https://img-fotki.yandex.ru/get/48807/158289418.3e5/0_176dc5_395b486d_XL.png

https://img-fotki.yandex.ru/get/9116/158289418.3e5/0_176dc6_6b0b4f76_XL.png



https://img-fotki.yandex.ru/get/52127/158289418.3e3/0_176a8c_f8137db4_orig.gif

https://img-fotki.yandex.ru/get/197807/158289418.3e3/0_176a8d_7fce694f_XL.png

https://img-fotki.yandex.ru/get/55828/158289418.3e3/0_176a8e_a93244e3_XL.png

https://img-fotki.yandex.ru/get/194778/158289418.3e3/0_176a8f_ea1b182_XL.png

https://img-fotki.yandex.ru/get/197756/158289418.3e3/0_176a90_e00cc5d2_XL.png

https://img-fotki.yandex.ru/get/62701/158289418.3e3/0_176a91_926d0146_XL.png

https://img-fotki.yandex.ru/get/176331/158289418.3e3/0_176a92_8770b630_XL.png

https://img-fotki.yandex.ru/get/177902/158289418.3e3/0_176a93_10824faf_XL.png

https://img-fotki.yandex.ru/get/94596/158289418.3e3/0_176a94_78259010_XL.png

https://img-fotki.yandex.ru/get/226827/158289418.3e3/0_176a95_3d306123_XL.png


Пикотех, зима 2016-2017. Периодичность в структурах белковых молекул.

Пиокотехнология белков

Ветвь форума Лабораории Наномир

Пикотехнология белков, ДНК, РНК - 2



Формы, механизмы, энергия наномира. Сообщение 83 644

Skype, 2016-12-30:

[13:22:53] Кушелев Александр Юрьевич: Научный прорыв в пикотехнологии: http://nanoworld.org.ru/post/81299/#p81299
[15:12:18] Потенциальный инвестор: Что это дает и что предлагаете? Прошу кратко пояснить суть инновации...  (wave)
[16:43:05] Кушелев Александр Юрьевич: Пикотехнология проверена окончательно. Вероятность случайного замыкания цикла лизоцима из 22 аминокислотных остатов равна 1/30 000 000 000, вероятность случайного образования кольца из 48 аминокислотных остатков равна 4^-48=10^-29. Точность пикотехнологии в 1000-10 000 раз выше точности рентгеноструктурного анализа (РСА). Скорость выше примерно в миллион раз. РСА может работать только с кристаллами. Это 3% всех типов белков. Пикотех работает дополнительно с 97% типов белков. Ежедневно кто-то оплачивает по старой технологии более 30 белковых структур в среднем по 10 000 евро. Я на одном компьютере могу ежедневно определять до 100 белковых структур, т.е. зарабатывать до миллиона евро в день. Осталось оформить документы...


Формы, механизмы, энергия наномира. Сообщение 83 639

Пикотехнология белков, ДНК, РНК - 2

Кушелев: Видео, на котором были открыты кольца из 48 аминокислотных остатков белка 3UAO:

https://img-fotki.yandex.ru/get/169451/158289418.3af/0_16ee56_41bc4a05_S.png  https://img-fotki.yandex.ru/get/98645/158289418.3af/0_16ee52_2651075e_S.png  https://img-fotki.yandex.ru/get/194858/158289418.3af/0_16ee65_cd422908_S.gif

Такой композиционный код формирует эти кольца:

144443144443144443144443144443144443144443144443

Замыкание (как минимум трижды!) кольца из 48 аминокислотных остатков в модели фрагмента белка 3UAO:

Вероятность случайного замыкания = 4^-48 = 10^-29



http://nanoworld88.narod.ru/data/025_files/1.gif
Замыкание фрагмента модели лизоцима на 22-ом аминокислотном остатке (вероятность случайного замыкания = 1/30 000 000 000)



Формы, механизмы, энергия наномира. Сообщение 83 625

Пикотехнология белков, ДНК, РНК - 2

http://www.rcsb.org/pdb/explore/explore … ureId=3UA0

3UA0
N-Terminal Domain of Bombyx mori Fibroin Mediates the Assembly of Silk in Response to pH Decrease

https://img-fotki.yandex.ru/get/94596/158289418.3af/0_16ee25_31ace4cc_orig.png

http://www.uniprot.org/uniprot/P05790

http://www.ebi.ac.uk/ena/data/view/AAF76983

>ENA|AAF76983|AAF76983.1 Bombyx mori (domestic silkworm) fibroin heavy chain Fib-H
ATGAGAGTCAAAACCTTTGTGATCTTGTGCTGCGCTCTGCAGTATGTCGCTTATACAAAT
GCAAACATCAATGATTTTGATGAGGACTATTTTGGGAGTGATGTCACTGTCCAAAGTAGT
AATACAACAGATGAAATAATTAGAGATGCATCTGGGGCAGTTATCGAAGAACAAATTACA
ACTAAAAAAATGCAACGGAAAAATAAAAACCATGGAATACTTGGAAAAAATGAAAAAATG
ATCAAGACGTTCGTTATAACCACGGATTCCGACGGTAACGAGTCCATTGTAGAGGAAGAT
GTGCTCATGAAGACACTTTCCGATGGTACTGTTGCTCAAAGTTATGTTGCTGCTGATGCG
GGAGCATATTCTCAGAGCGGGCCATACGTATCAAACAGTGGATACAGCACTCATCAAGGA
TATACGAGCGATTTCAGCACTAGTGCTGCAGTCGGTGCAGGAGCTGGTGCAGGTGCTGCC
GCTGGTTCTGGTGCGGGTGCCGGAGCTGGTTATGGAGCTGCTTCTGGTGCTGGTGCCGGT
GCTGGGGCTGGTGCCGGAGCTGGTTATGGAACTGGTGCAGGTGCAGGTGCCGGAGCTGGT
TATGGAGCTGGTGCAGGTGCAGGTGCCGGAGCTGGTTATGGGGCTGGTGCAGGTGCAGGT
GCCGGAGCTGGTTATGGAGCTGGTGCAGGTGCAGGTGCCGGAGCTGGTTATGGGGCTGGT
GCAGGTGCAGGTGCCGGAGCTGGTTATGGAGCTGGTGCGGGTGCCGGTGCCGGGGCTGGT
TATGGAGCTGCCTCTGGTGCTGGTGCTGGCGCTGGGTACGGACAAGGAGTAGGAAGCGGA
GCTGCTTCTGGAGCTGGTGCAGGTGCAGGAGCAGGTTCTGCCGCTGGTTCTGGGGCAGGT
GCCGGTGCTGGTACCGGTGCTGGTGCAGGTTACGGAGCTGGTGCAGGTGCCGGTGCCGGA
GCTGGTTATGGAGCTGCCTCTGGTACTGGAGCAGGTTATGGAGCTGGTGCCGGAGCTGGT
TACGGAGGTGCCTCTGGTGCTGGTGCTGGTGCCGGTGCTGGGGCTGGAGCCGGTGCTGGT
GCAGGTTATGGAACTGGCGCTGGATACGGAGCAGGAGCCGGAGCAGGAGCCGGAGCAGGA
GCTGGTGCTGGATACGGAGCAGGAGCTGGTGCTGGATACGGAGCAGGATATGGAGTAGGA
GCTGGTGCTGGATACGGAGCAGGATACGGAGCAGGAGCTGGAAGCGGAGCTGCCTCTGGT
GCTGGTTCAGGTGCCGGTGCTGGTTCAGGTGCCGGTGCTGGTTCAGGTGCCGGTGCTGGT
TCAGGTGCCGGTGCCGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGT
GCTGGTGCAGGTTCAGGTGCTGGTGCTGGTTCAGGTACTGGTGCTGGTTCAGGAGCTGGT
GCTGGATACGGAGCAGGAGCTGGTGCTGGATACGGAGCAGGAGCAGGAAGTGGAGCTGCC
TCTGGTGCCGGTGCTGGTTCAGGTGCAGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGT
GCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGAGCTGGTGCTGGATACGGAGCAGGA
GCTGGTGCTGGATACGGAGCAGGAGCTGGTGCTGGATACGGAGCAGGAGCTGGCGTTGGA
TACGGAGCAGGAGCTGGAAGCGGAGCTGCCTCTGGTGCTGGTGCTGGTTCAGGAGCCGGT
GCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGT
TCAGGTGCCGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGAGCTGGTGCTGGTTCAGGT
GCTGGTGCTGGTTCAGGAGCTGGAGTTGGATACGGAGCAGGAGTTGGTGCTGGATACGGA
GCAGGATATGGAGCAGGAGCTGGTGCTGGATACGGAGCAGGAGCAGGAAGCGGAGCTGCC
TCTGGTGCTGGTGCCGGTGCTGGAGCTGGTGCAGGAACAGGCTCTTCTGGATTTGGACCA
TATGTAGCAAATGGCGGATATAGCAGAAGTGATGGCTACGAATACGCTTGGTCGTCTGAC
TTTGGAACTGGAAGCGGAGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGC
GCTGGCTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGAGCTGGAGCTGGA
TACGGAGCAGGAGTTGGTGTTGGATACGGAGCAGGATATGGAGCAGGAGCTGGTGCTGGA
TACGGAGCAGGAGCAGGAAGCGGAGCTGCCTCTGGTGCCGGTGCTGGTTCAGGTGCTGGT
GCTGGTTCAGGTGCCGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCCGGTGCTGGT
TCAGGTGCTGGTGCTGGCTCAGGTGCCGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGT
GCCGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGTTGGCTCAGGTGCTGGT
GCTGGTTCAGGTGCTGGTGCTGGCGTTGGATACGGAGCAGGAGCTGGCGTTGGATACGGA
GCAGGAGCTGGAAGCGGAGCTGCCTCTGGTGCTGGTGCTGGTTCAGGAGCCGGTGCTGGT
TCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGT
GCCGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGAGCTGGTGCTGGTTCAGGTGCTGGT
GCTGGTTCAGGAGCTGGAGTTGGATACGGAGCAGGAGTTGGTGCTGGATACGGAGCAGGA
TATGGAGCAGGAGCTGGTGCTGGATACGGAGCAGGAGCAGGAAGCGGAGCTGCCTCAGGT
GCCGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCCGGTGCTGGTTCAGGTGCTGGT
GCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGT
TCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGCTCAGGTGCTGGAGCTGGTTCAGGT
GCTGGTGCTGGTTCAGGAGCTGGAGCTGGATACGGAGCAGGAGCTGGTGCTGGATACGGA
GCAGGATATGGAGCAGGAGCTGGTGCTGGATACGGAGCAGGAGCTGGAAGCGGAGCTGCC
TCTGGTGCTGGTTCAGGTGCCGGTGCTGGTTCAGGTGCCGGTGCTGGTGCTGGTTCAGGT
GCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGCTCAGGTGCTGGA
GCTGGTTCAGGTGCTGGTGCTGGTTCAGGAGCTGGAGCTGGATACGGAGCAGGAGTTGGT
GCTGGATACGGAGCAGGATATGGAGCAGGAGCTGGTGCTGGATACGGAGCAGGAGCAGGA
AGCGGAGCTGCCTCTGGTGCCGGTGCTGGTTCAGGTGCTGGAGCTGGTTCAGGTGCCGGT
GCTGGTTCAGGTGCTGGTGCTGGTTCAGGAGCTGGTGCTGGTTCAGGAGCTGGTGCTGGT
TCAGGTGCTGGTGCTGGTTCAGGAGCTGGAGTTGGATACGGAGCAGGATATGGAGCAGGA
GCTGGTGCTGGATACGGAGCAGGAGCAGGAAGCGGAGCTGCCTCTGGTGCTGGTGCCGGT
GCTGGAGCTGGTGCAGGAACAGGCTCTTCTGGATTTGGACCATATGTAGCACATGGCGGA
TATAGCGGCTACGAATACGCTTGGTCGTCAGAATCTGACTTTGGAACTGGAAGCGGAGCT
GGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGCTCAGGTGCTGGTGCT
GGTTCAGGAGCTGGATACGGAGCAGGAGTTGGTGCTGGATACGGAGCAGGATATGGAGCA
GGAGCTGGTGCTGGATACGGAGCAGGAGCAGGAAGCGGAGCTGGCTCAGGTGCTGGTGCT
GGTTCAGGAGCTGGAGCTGGTTCAGGTGCCGGTGCTGGTTCAGGTGCTGGTGCTGGTTCA
GGAGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGAGCTGGTGCTGGTTCAGGTGCC
GGTGCTGGTTCAGGTGCTGGTGCTGGATACGGAGCAGGATATGGAGCAGGAGCTGGTGCT
GGATACGGAGCAGGAGCAGGAAGCGGAGCTGGCTCAGGTGCTGGTGCTGGTTCAGGTGCT
GGTGCTGGTTCAGGAGCTGGAGCTGGTTCAGGTGCCGGTGCTGGTTCAGGTGCTGGTGCT
GGTTCAGGTGCTGGTGCTGGCTCAGGTGCTGGTGCTGGTTCAGGAGCTGGAGCTGGATAC
GGAGCAGGAGTTGGTGCTGGATACGGAGCAGGATATGGAGCAGGAGCTGGTGCTGGATAC
GGAGCAGGAGCAGGAAGCGGAGCTGGCTCAGGTGCTGGTGCTGGTTCAGGAGCTGGAGCT
GGTTCAGGTGCTGGTGCTGGTTCAGGTGCCGGTGTTGGTTCAGGTGCTGGTGCTGGTTCA
GGAGCTGGTGCTGGTTCAGGTGCCGGTGCTGGTTCAGGTGCTGGTGCTGGATACGGAGCA
GGATATGGAGCAGGAGCTGGTGCTGGATACGGAGCAGGAGCAGGAAGCGGAGCTGGCTCA
GGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGAGCTGGAGCTGGTTCAGGTGCC
GGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGAGCTGGTGCTGGTTCAGGTGCTGGTGCT
GGTTCAGGAGCTGGAGTTGGATACGGAGCAGGAGTTGGTGCTGGATACGGAGCAGGATAT
GGAGCAGGAGCTGGTGCTGGATACGGAGCAGGAGCAGGAAGCGGAGCTGCCTCTGGTGCT
GGTGCCGGTGCTGGAGCTGGTGCAGGAACAGGCTCTTCTGGATTTGGACCATATGTAGCA
AATGGCGGATATAGCGGCTACGAATACGCTTGGTCGTCAGAATCTGACTTTGGAACTGGA
AGCGGAGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGCTCAGGT
GCTGGTGCTGGTTCAGGAGCTGGAGCTGGATACGGAGCAGGATATGGAGCAGGAGCTGGT
GCTGGATACGGAGCAGGAGCAGGAAGCGGAGCTGGCTCAGGTGCTGGTGCTGGTTCAGGA
GCTGGAGCTGGTTCAGGTGCCGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCCGGT
GCTGGTTCAGGTGCTGGTGCTGGTTCAGGAGCTGGTGCTGGTTCAGGTGCCGGTTCTGGT
TCAGGAGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGAGCTGGAGCTGGATACGGA
GCAGGAGTTGGTGCTGGATACGGAGTAGGATATGGAGCAGGAGCTGGTGCTGGATACGGA
GCAGGAGCAGGAAGCGGAGCTGCCTCTGGTGCTGGTGCCGGTGCTGGAGCTGGTGCAGGA
ACAGGCTCTTCTGGATTTGGACCATATGTAGCACATGGCGGATATAGCGGCTACGAATAC
GCTTGGTCGTCAGAATCTGACTTTGGAACTGGAAGCGGAGCTGGTGCTGGTTCAGGTGCT
GGTGCTGGTTCAGGTGCTGGTGCTGGCTCAGGTGCTGGTGCTGGTTCAGGAGCTGGTGCT
GGTTCAGGTGCTGGTGCTGGTTCAGGAGCTGGAGCTGGATACGGAGCAGGAGTTGGTGCT
GGATACGGAGCAGCATATGGAGCAGGAGCTGGTGCTGGATACGGAGCTGGAGCAGGAAGC
GGAGCTGCCTCTGGTGCCGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCCGGTGCT
GGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCA
GGTGCTGGTGCTGGTTCAGGAGCTGGTGCTGGTTCAGGAGCTGGTGCTGGTTCAGGTGCC
GGTGCTGGTTCAGGAGCTGGAGCAGGATATGGAGCAGGAGCTGGTGCTGGATACGGAGCA
GGAGCAGGAAGCGGAGCTGGCTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCA
GGAGCTGGAGCTGGTTCAGGTGCCGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCC
GGTTCTGGTTCAGGAGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGAGCTGGAGCT
GGATACGGAGCAGGAGTTGGTGCTGGATACGGAGCAGGATATGGAGCAGGAGCTGGTGCT
GGATACGGAGCAGGAGCAGGAAGCGGAGCTGGCTCAGGTGCCGGTGCTGGTTCAGGAGCT
GGAGCAGGATATGGAGCAGGAGCTGGTGCTGGATACGGAGCAGGATATGGAGCAGGAGCT
GGTGCTGGATACGGAGCAGGAGCAGGAACCGGAGCTGGCTCAGGTGCTGGTGCTGGTTCA
GGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGAGCTGGAGCTGGTTCAGGTGCC
GGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCCGGTTCTGGTTCAGGTGCTGGTGCT
GGTTCAGGAGCTGGAGCTGGTTCAGGTGCCGGTGCTGGTTCAGGTGCTGGTGCTGGTTCA
GGTGCTGGTGCTGGTTCAGGAGCTGGAGCTGGATACGGAGCAGGAGCTGGTGCTGGATAC
GGAGCAGGATATGGAGCAGGAGCTGGTGCTGGATACGGAGCAGGAGCAGGAAGCGGTGCT
GGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCA
GGAGCTGGTGCTGGATATGGAGCTGGATACGGAGCAGGAGCTGGAAGCGGAGCTGCCTCT
GGTGCTGGTGCCGGTGCTGGAGCTGGTGCAGGAACAGGCTCTTCTGGATTTGGACCATAT
GTAGCACATGGCGGATATAGCGGCTACGAATACGCTTGGTCGTCAGAATCTGACTTTGGA
ACTGGAAGCGGAGCTGGTGCTGGTTCAGGTGCTGGTGCTGGCGCAGGTGCTGGTGCTGGT
TCAGGAGCTGGAGCTGGATACGGAGCAGGAGTTGGTGCTGGATACGGAGCAGGATATGGA
GCAGGAGCTGGTGCTGGATACGGAGCAGGAGCAGGAAGCGGAACTGGCTCAGGTGCTGGT
GCTGGTTCAGGAGCTGGAGCTGGATACGGAGCAGGAGTTGGTGCTGGATACGGAGCAGGA
GCAGGAAGCGGAGCTGCCTTTGGTGCCGGTGCTGGTGCTGGTGCTGGTTCAGGTGCCGGT
GCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGT
TCAGGAGCTGGTGCTGGATACGGAGCAGGGTACGGAGCAGGAGTTGGTGCTGGATACGGA
GCAGGAGCTGGAAGCGGAGCTGCCTCTGGTGCCGGTGCTGGTTCAGGTGCTGGTGCTGGT
TCAGGTGCCGGTGCTGGTTCAGGTGCTGGTGCTGGCTCAGGTGCTGGTGCTGGTTCAGGA
GCTGGAGCTGGATACGGAGCAGGAGTTGGTGCTGGATACGGAGCAGGATATGGAGCAGGA
GCTGGTGCTGGATACGGAGCTGGAGCAGGAAGCGGAGCTGCCTCTGGTGCCGGTGCTGGT
TCAGGTGCTGGTGCTGGTGCTGGTTCAGGTGCCGGTGCTGGTTCAGGTGCTGGTGCTGGT
TCAGGTGCTGGTGCTGGTTCAGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCCGGT
GCTGGTTCAGGAGCTGGTGCTGGATACGGAGCAGGAGCAGGAAGCGGAGCTGCCTCTGGT
GCTGGTGCCGGTGCTGGAGCTGGTGCAGGAACAGGCTCTTCTGGATTTGGACCATATGTA
GCAAATGGCGGATATAGCGGCTACGAATACGCTTGGTCGTCAGAATCTGACTTTGGAACT
GGAAGCGGAGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGCTCA
GGTGCTGGTGCTGGTTCAGGAGCTGGAGCTGGATACGGAGCAGGAGTTGGTGCTGGATAC
GGAGCAGGATATGGAGCAGGAGCTGGTGCTGGATACGGAGCAGGAGCAGGAAGCGGAGCT
GGCTCAGGTGCTGGTGCTGGTTCAGGAGCTGGAGCTGGTTCAGGTGCCGGTGCTGGTTCA
GGTGCTGGTGCTGGTTCAGGTGCCGGTGCTGGTTCAGGTGCTGGGGCTGGTTCAGGAGCT
GGTGCTGGATACGGAGCAGGAGCAGGAAGCGGAGCTGCCTCTGGTGCCGGTGCTGGTTCA
GGTGCTGGTGCTGGTTCAGGTGCCGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGAGCT
GGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGAGCTGGAGCTGGATACGGAGCAGGAGTT
GGTGCTGGATACGGAGTAGGATATGGAGCAGGAGCTGGTGCTGGATACGGAGCAGGAGCA
GGAAGCGGAGCTGGCTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCC
GGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCCGGTTCAGGTGCTGGTGCTGGTTCA
GGAGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTTCAGGTGCTGGTGCT
GGCTCAGGTGCTGGTGCTGGATACGGAGTAGGATATGGAGCAGGAGCTGGTGCTGGATAC
GGAGCAGGAGCAGGAAGCGGAGCTGGCTCAGGTGCTGGTGCTGGGTCAGGTGCCGGTGCT
GGTTCAGGTGCTGGTGCTGGTTCAGGTGCCGGTTCAGGTGCTGGTGCTGGTTCAGGAGCT
GGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGAGCTGGAGCTGGATACGGAGCAGGAGTT
GGTGCTGGATACGGAGTAGGATATGGAGCAGGAGCTGGTGCTGGATACGGAGCAGGAGCA
GGAAGCGGAGCTGGCTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCC
GGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGAGCTGGTGCTGGTTCAGGTGCCGGTGCT
GGTTCAGGTGCTGGTGCTGGTTCAGGTGCCGGTTCAGGTGCTGGTGCTGGTTCAGGAGCT
GGTGCTGGTTCAGGTGCCGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCCGGTTCA
GGTGCTGGTGCTGGTTCAGGAGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGAGCT
GGAGCTGGATACGGAGCAGGAGTTGGTGCTGGATACGGAGTAGGATATGGAGCAGGAGTT
GGTGCTGGATACGGAGCAGGAGCAGGAAGCGGAGCTGCCTCTGGTGCCGGTGCTGGTTCA
GGTGCTGGTGCTGGTGCTGGTTCAGGTGCCGGTGCTGGTTCAGGTGCTGGTGCTGGTTCA
GGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGAGCT
GGTGCTGGATACGGAGCAGGGTACGGAGCAGGAGTTGGTGCTGGATACGGAGCAGGAGCT
GGCGTTGGATACGGAGCAGGAGCTGGCGCTGGATACGGAGCAGGAGCTGGAAGCGGAGCT
GCCTCTGGTGCCGGTGCTGGTGCTGGTTCAGGTGCCGGTGCTGGTACAGGTGCTGGGGCT
GGTTCAGGAGCTGGTGCTGGATACGGAGCAGGAGCAGGAAGCGGAGCTGCCTCTGGTGCT
GGTGCCGGTGCTGGAGCTGGTGCAGGAACAGGCTCTTCTGGATTTGGACCATATGTAGCA
AATGGCGGATATAGCGGCTACGAATACGCTTGGTCGTCAGAATCTGACTTTGGAACTGGA
AGCGGAGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGCTCAGGT
GCTGGTGCTGGTTCAGGAGCTGGAGCTGGATACGGAGCAGGAGTTGGTGCTGGATACGGA
GCAGGAGCAGGAAGCGGAGCTGGCTCAGGTGCTGGTGCTGGTTCAGGAGCTGGAGCTGGT
TCAGGTGCTGGTGCTGGTTCAGGAGCTGGTGCTGGTTCAGGAGCTGGAGCTGGATACGGA
GCAGGAGCAGGAAGCGGAACTGGCTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGT
TCAGGTGCCGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGAGCTGGTGCTGGTTCAGGT
GCTGGTGCTGGTTCAGGAGTTGGTGCTGGATACGGAGTAGGATATGGAGCAGGAGCTGGT
GCTGGATACGGAGTAGGATATGGAGCAGGAGCTGGTGCTGGATACGGAGCAGGAGCAGGA
AGCGGAACTGGCTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCCGGT
GCTGGTTCAGGTGCTGGTGCTGGTTCAGGAGCTGGTGCTGGTTCAGGTGCTGGTGCTGGT
TCAGGAGCTGGAGCTGGATACGGAGCAGGAGTTGGTGCTGGATACGGAGTAGGATATGGA
GCAGGAGCTGGTGCTGGATACGGAGCAGGAGCAGGAAGCGGAGCTGGCTCAGGTGCTGGT
GCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCCGGTGCTGGTTCAGGTGCTGGTGCTGGT
TCAGGTGCCGGTTCAGGTGCTGGTGCTGGTTCAGGAGCTGGTGCTGGTTCAGGTGCTGGT
GCTGGTTCAGGTGCTGGTTCAGGTGCTGGTGCTGGCTCAGGTGCTGGTGCTGGATACGGA
GTAGGATATGGAGCAGGAGCTGGTGCTGGATACGGAGCAGGAGCAGGAAGCGGAGCTGGC
TCAGGTGCTGGTGCTGGGTCAGGTGCCGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGT
GCCGGTTCAGGTGCTGGTGCTGGTTCAGGAGCTGGTGCTGGTTCAGGTGCTGGTGCTGGT
TCAGGAGCTGGAGCTGGATACGGAGCAGGAGTTGGTGCTGGATACGGAGTAGGATATGGA
GCAGGAGCTGGTGCTGGATACGGAGCAGGAGCAGGAAGCGGAGCTGGCTCAGGTGCTGGT
GCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCCGGTGCTGGTTCAGGTGCTGGTGCTGGT
TCAGGAGCTGGTGCTGGTTCAGGTGCCGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGT
GCCGGTTCAGGTGCTGGTGCTGGTTCAGGAGCTGGTGCTGGTTCAGGTGCTGGTGCTGGT
TCAGGAGCTGGAGCTGGATACGGAGCAGGAGTTGGTGCTGGATACGGAGTAGGATATGGA
GCAGGAGCTGGTGCTGGATACGGAGCAGGAGCAGGAAGCGGAGCTGCCTCTGGTGCTGGT
GCCGGTGCTGGAGCTGGTGCAGGAACAGGCTCTTCTGGATTTGGACCATATGTAGCAAAT
GGCGGATATAGCGGCTACGAATACGCTTGGTCGTCAGAATCTGACTTTGGAACTGGAAGC
GGAGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGAGCTGGTGCTGGATACGGAGCA
GGGTACGGAGCAGGAGTTGGTGCTGGATACGGAGCAGGAGCTGGCGTTGGATACGGAGCA
GGAGCTGGCGCTGGATACGGAGCAGGAGCTGGAAGCGGAGCTGCCTCTGGTGCCGGTGCT
GGTGCCGGTGCTGGTGCTGGTTCAGGTGCCGGTGCTGGTTCAGGTGCTGGTGCTGGTGCT
GGTTCAGGAGCTGGTGCTGGATACGGAGCAGGGTACGGAATAGGAGTTGGTGCTGGATAC
GGAGCAGGAGCTGGCGTTGGATACGGAGCAGGAGCTGGCGCTGGATACGGAGCAGGAGCT
GGAAGCGGAGCTGCCTCTGGTGCCGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCT
GGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCT
GGTTCAGGAGCTGGTGCTGGATACGGAGCAGGGTACGGAGCAGGAGTTGGTGCTGGATAC
GGAGCAGGAGCTGGCGTTGGATACGGAGCAGGAGCTGGCGCTGGATACGGAGCAGGAGCT
GGAAGCGGAGCTGCCTCTGGTGCCGGTGCTGGTGCCGGTGCTGGTGCTGGTGCTGGTTCA
GGTGCCGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGAGCT
GGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCT
GGCTCAGGTGCTGGTGCTGGTTCAGGAGCTGGAGCTGGATACGGAGCAGGAGTTGGTGCT
GGATACGGAGCAGGATATGGAGGAGCTGGTGCTGGATACGGAGCAGGAGCAGGAAGCGGA
GCTGCCTCTGGTGCCGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGAGCTGGTGCTGGT
TCAGGTGCTGGTGCTGGTTCAGGTGCTGGGGCTGGTTCAGGTGCTGGTGCTGGATACGGA
GCAGGAGCAGGAAGCGGAGCTGCCTCTGGTGCTGGTGCCGGTGCTGGAGCTGGTGCAGGA
ACAGGCTCTTCTGGATTTGGACCATATGTAAATGGCGGATATAGCGGCTACGAATACGCT
TGGTCGTCAGAATCTGACTTTGGAACTGGAAGCGGAGCTGGTGCTGGCTCAGGTGCTGGT
GCTGGTTCAGGAGCTGGAGCTGGATACGGAGCAGGAGTTGGTGCTGGATACGGAGCAGGA
TATGGAGCAGGAGCTGGTGCTGGATACGGAGCAGGAGCAGGAAGCGGAGCTGCCTCTGGT
GCCGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCCGGTGCTGGTTCAGGTGCTGGT
GCTGGTTCAGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGT
GCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGAGCTGGA
GCTGGATACGGAGCAGGAGTTGGTGCTGGATACGGAGCAGGATATGGAGCAGGAGCTGGT
GCTGGATACGGAGCAGGAGCAGGAAGCGGAGCTGCYTCTGGCGCCGGTGCTGGTTCAGGT
GCTGGTGCTGGTGCTGGTTCAGGTGCCGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGT
GCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGT
TCAGGTGCTGGTGCTGGTTCAGGAGCTGGTGCTGGATACGGAGCAGGGTACGGAGCAGGA
GTTGGTGCTGGATACGGAGCAGGAGCTGGCGTTGGATACGGAGCAGGAGCTGGCGCTGGA
TACGGAGCAGGAGCTGGAAGCGGAGCTGCCTCTGGTGCCGGTGCTGGTTCAGGTTCTGGT
GCTGGTTCAGGTGCCGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGT
GCTGGTTCAGGTGCTGGGGCTGGTTCAGGAGCTGGTGCTGGTTCAGGAGCTGGTGCTGGA
TACGGAGCAGGGTACGGAGCAGGAGCAGGAAGCGGAGCTGCCTCTGGTGCTGGTGCCGGT
GCTGGAGCTGGTGCAGGAACAGGCTCTTCTGGATTTGGACCATATGTAGCAAATGGCGGA
TATAGCGGCTACGAATACGCTTGGTCGTCAGAATCTGACTTTGGAACTGGAAGCGGAGCT
GGTGCTGGCTCAGGTGCTGGTGCTGGTTCAGGAGCTGGAGCTGGATACGGAGCAGGAGTT
GGTGCTGGTTACGGAGCAGGATATGGAGCAGGAGCTGGTGCTGGATACGGAGCAGGAGCA
GGAAGCGGAGCTGGCTCAGGTGCCGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCC
GGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGAGCTGGTGCTGGTTCAGGTGCTGGTGCT
GGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGATACGGAGCAGGATACGGAGCA
GGAGCTGGTGCTGGATACGGAGCAGGAGCTGGCGTTGGATACGGAGCAGGAGCTGGCGCT
GGATACGGAGCAGGAGCTGGAAGCGGAGCTGGCTCTGGTGCCGGTGCTGGTTCAGGTTCT
GGTGCTGGTGCTGGTTCAGGTTCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCT
GGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGAGCTGGTGCTGGTTCAGGTGCTGGTGCT
GGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGATACGGAGCAGGGTACGGAATA
GGAGTTGGTGCTGGATACGGAGCAGGAGCTGGCGTTGGATACGGAGCAGGAGCTGGCGCT
GGATACGGAGCAGGAGCTGGAAGCGGAGCTGCCTCTGGTGCCGGTGCTGGTTCAGGTGCT
GGTGCTGGTTCAGGAGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCT
GGTTCAGGTGCTGGTGCTGGTTCAGGAGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCA
GGTGCTGGTGCTGGTTCAGGAGCTGGTGCTGGATACGGAGCAGGAGCTGGCGTTGGATAC
GGAGCAGGAGCTGGAAGCGGAGCTGCCTCTGGTGCTGGTGCTGGTTCAGGTGCTGGTGCT
GGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCA
GGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTTCAGGTGCTGGTGCT
GGCTCAGGTGCTGGTGCTGGATACGGAGCAGGGTACGGAGCAGGAGTTGGTGCTGGATAC
GGAGCAGGTGCTGGATACGGAGCAGGATATGGAGTAGGAGCTGGTGCTGGATACGGAGCA
GGAGCAGGAAGCGGAGCTGGCTCTGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCA
GGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCT
GGTTCAGGAGCTGGTGCTGGATACGGAGCAGGAGCTGGCGCTGGATACGGAGCAGGAGCT
GGCGCTGGATACGGAGCAGGAGCTGGAAGCGGAGCTGCCTCTGGTGCTGGTGCTGGTGCC
GGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCTGGTTCA
GGTGCTGGTGCTGGTTCAGGAGCTGGTGCTGGATACGGAGCAGGAGCTGGAAGCGGAGCT
GCCTCTGGTGCCGGTGCTGGTTCAGGTGCTGGTGCTGGTGCTGGTGCCGGTGCTGGTGCT
GGTTCAGGAGCTGGTGCTGGTTCAGGAGCTGGTGCTGGATACGGAGCAGGAGCAGGAAGT
GGAGCTGCCTCTGGTGCTGGTGCTGGAGCTGGTGCAGGAACAGGCTCTTCTGGATTTGGA
CCATATGTAGCAAATGGCGGATATAGCAGACGTGAAGGCTACGAATACGCTTGGTCGTCA
AAATCTGACTTTGAAACTGGAAGCGGTGCTGCCTCTGGTGCTGGTGCTGGTGCTGGTTCA
GGTGCTGGTGCTGGTTCAGGTGCCGGTGCTGGTTCAGGTGCTGGTGCTGGTTCAGGTGCC
GGTGCTGGTGGTAGCGTCAGTTACGGAGCTGGCAGGGGATACGGACAAGGTGCAGGAAGT
GCAGCTTCCTCTGTGTCATCTGCTTCATCTCGCAGTTACGACTATTCTCGTCGTAACGTC
CGCAAAAACTGTGGAATTCCTAGAAGACAACTAGTTGTTAAATTCAGAGCACTGCCTTGT
GTGAATTGCTAA

https://img-fotki.yandex.ru/get/198026/ … 5_orig.gif

https://img-fotki.yandex.ru/get/198998/158289418.3ae/0_16eddf_96b095f6_M.pnghttps://img-fotki.yandex.ru/get/196365/158289418.3ae/0_16ede0_787e98e8_M.png
Программная спираль (повторяющиеся участки)

https://img-fotki.yandex.ru/get/196060/158289418.3ae/0_16ede1_fb68972f_orig.png
Программная спираль 2122212221222

https://img-fotki.yandex.ru/get/195648/158289418.3ae/0_16ede2_2d0bd66_M.pnghttps://img-fotki.yandex.ru/get/198569/158289418.3ae/0_16ede5_afa1beae_M.png
Программная спираль

https://img-fotki.yandex.ru/get/198026/158289418.3ae/0_16ede3_c81e14a0_orig.png
Программная спираль

https://img-fotki.yandex.ru/get/196141/158289418.3ae/0_16ede4_a615b51b_S.pnghttps://img-fotki.yandex.ru/get/196121/158289418.3ae/0_16ede6_a539b248_S.pnghttps://img-fotki.yandex.ru/get/198786/158289418.3ae/0_16edec_b7ae063b_S.pnghttps://img-fotki.yandex.ru/get/196365/158289418.3ae/0_16edef_358513b0_S.pnghttps://img-fotki.yandex.ru/get/176331/158289418.3af/0_16ee01_d038ec26_S.png
Программная спираль 3332333332333332333332

https://img-fotki.yandex.ru/get/46412/158289418.3ae/0_16ede7_b672b38d_S.pnghttps://img-fotki.yandex.ru/get/194492/158289418.3ae/0_16ede8_f26efdc1_S.pnghttps://img-fotki.yandex.ru/get/198026/158289418.3ae/0_16eded_3f3cfafe_S.pnghttps://img-fotki.yandex.ru/get/198569/158289418.3ae/0_16edf0_decd47a8_S.pnghttps://img-fotki.yandex.ru/get/104403/158289418.3ae/0_16edf1_459995c5_S.pnghttps://img-fotki.yandex.ru/get/194541/158289418.3ae/0_16edf2_56c83e4_S.pnghttps://img-fotki.yandex.ru/get/198026/158289418.3ae/0_16edf3_7660b08a_S.pnghttps://img-fotki.yandex.ru/get/196060/158289418.3ae/0_16edf4_9d9f2512_S.pnghttps://img-fotki.yandex.ru/get/198026/158289418.3ae/0_16edf5_4ad95076_S.png Многократно повторяющаяся структура архитектурного перевертыша

https://img-fotki.yandex.ru/get/198569/158289418.3ae/0_16ede9_2e0b7ae9_S.pnghttps://img-fotki.yandex.ru/get/198026/158289418.3ae/0_16edea_2b234d68_S.pnghttps://img-fotki.yandex.ru/get/198569/158289418.3ae/0_16ede9_2e0b7ae9_S.png
Многократно повторяющаяся структура

https://img-fotki.yandex.ru/get/196121/158289418.3ae/0_16edf8_69bc7815_orig.png
Программная спираль 22322232223

https://img-fotki.yandex.ru/get/198026/158289418.3ae/0_16edf6_6bc89efe_M.pnghttps://img-fotki.yandex.ru/get/198569/158289418.3ae/0_16edf7_b7f808f7_M.png
Многократно повторяющаяся структура

https://img-fotki.yandex.ru/get/198026/158289418.3af/0_16edfc_894ee0f2_S.pnghttps://img-fotki.yandex.ru/get/28561/158289418.3af/0_16edfd_1c15d955_S.pnghttps://img-fotki.yandex.ru/get/198026/158289418.3af/0_16ee03_c171493a_S.pnghttps://img-fotki.yandex.ru/get/198998/158289418.3af/0_16ee04_8b69ad0_S.pnghttps://img-fotki.yandex.ru/get/194550/158289418.3af/0_16ee06_18e16a3b_S.pnghttps://img-fotki.yandex.ru/get/196121/158289418.3ae/0_16edfb_d5e86c69_S.pnghttps://img-fotki.yandex.ru/get/198026/158289418.3ae/0_16edf9_b63cc64c_S.png
Многократно повторяющаяся структура

https://img-fotki.yandex.ru/get/198569/158289418.3ae/0_16edfa_f9ad12f1_S.pnghttps://img-fotki.yandex.ru/get/196141/158289418.3af/0_16edff_eac3a90e_S.pnghttps://img-fotki.yandex.ru/get/199051/158289418.3af/0_16ee00_c5527dd1_S.pnghttps://img-fotki.yandex.ru/get/199051/158289418.3af/0_16ee02_8e406367_S.png
Многократно повторяющаяся структура

https://img-fotki.yandex.ru/get/198026/158289418.3af/0_16ee07_88c32b48_S.pnghttps://img-fotki.yandex.ru/get/198860/158289418.3af/0_16ee08_d674caf4_S.pnghttps://img-fotki.yandex.ru/get/196141/158289418.3af/0_16ee09_67cb5dc3_S.png
Многократно повторяющаяся структура

https://img-fotki.yandex.ru/get/176331/158289418.3af/0_16ee01_d038ec26_orig.png
Общая длина программной спирали 3332333332333332333332 достигает 132 аминокислотных остатка. Случайно такая последовательность могла бы образоваться с такой же вероятностью, как выпадение "орла" 264 раза, но не подряд, а периодично, т.е. с 510 броска 40 "орлов" подряд, с 580-го ещё 40 "орлов" подряд, с 878-го, 1074-го и с 3949-го. Вероятность такой последовательности событий равна 2^-264 = 3*10^-80. Понятно, что такая последовательность кодов не может быть случайной.

https://img-fotki.yandex.ru/get/198026/158289418.3af/0_16ee07_88c32b48_orig.png
В том же белке есть и другая длинная последовательность, которая тоже имеет ничтожную вероятность случайного образования (порядка 3*10^-80).

О том, что генетический код белков не является случайной комбинацией символов, мы знаем и из других источников. Эволюция генов идёт всё быстрее, т.к. более длинные нуклеотидные последовательности формируются из более коротких, например, многократным их повторением, что мы и наблюдаем в случае формирования программной спирали белковой молекулы.

Однако в данном случае мы видим последовательность именно композиционных кодов, т.е. кодов, управляющих взаимной ориентацией соседних аминокислотных остатков в белковой молекуле. И эти коды, как мы видим, тоже не случайны.

Попробуйте изменить таблицу композиционного кода. Что Вы получите вместо этих периодических структур?

Результат изменений таблицы и алгоритма композиционного кодирования, предпринятые Викторией Соколик, вы видите справа в виде серой полосы. Информация о периодической структуре белковой молекулы потеряна.

https://img-fotki.yandex.ru/get/52085/158289418.3af/0_16ee0b_64bf5df4_orig.png

Кстати,

https://img-fotki.yandex.ru/get/197700/158289418.3af/0_16ee11_9b3c8999_XL.png
Методом РСА (и не только!) не удалось обнаружить ни одного спирального участка в этом белке...



Формы, механизмы, энергия наномира. Сообщение 83 761

Готовится 581-ый выпуск рассылки "Новости лаборатории Наномир"

http://subscribe.ru/catalog/science.news.nanoworldnews

Дайджест:

581 Научный прорыв в пикотехнологии.
Как выглядит архитектурный нео-квази-перевертыш?
Анатомия диссонансных архитектурных перевертышей
РСА не может определить даже тип белка!
Найди иголку в стоге сена размером с планету...
Emdrive в СССР зарегистрирован в 1973 году!
https://img-fotki.yandex.ru/get/194588/158289418.3af/0_16ee53_83a9dbc_XL.png
https://img-fotki.yandex.ru/get/48069/158289418.3af/0_16ee92_bc86a07b_orig.gif
https://img-fotki.yandex.ru/get/198026/158289418.3af/0_16ee07_88c32b48_M.pnghttps://img-fotki.yandex.ru/get/198026/158289418.3af/0_16ee07_88c32b48_M.pnghttps://img-fotki.yandex.ru/get/198026/158289418.3af/0_16ee07_88c32b48_M.pnghttps://img-fotki.yandex.ru/get/198026/158289418.3af/0_16ee07_88c32b48_M.png

https://img-fotki.yandex.ru/get/53993/158289418.3ac/0_16eb67_fbaa04ba_M.pnghttps://img-fotki.yandex.ru/get/197852/158289418.3ac/0_16ebd9_19cb446f_M.png

https://img-fotki.yandex.ru/get/197213/158289418.3ac/0_16ebd3_d6672e1e_XL.pnghttps://img-fotki.yandex.ru/get/195786/158289418.3ac/0_16ebde_3ea398ad_XL.gif




Доходность ПИКОСОФТА

Бумажный вариант книги "ПИКОТЕХНОЛОГИЯ БЕЛКОВ" стоит в 74,90 ЕВРО.

Купить книгу "ПИКОТЕХНОЛОГИЯ БЕЛКОВ" у издателя







ПИКОТЕХНОЛОГИЯ БЕЛКОВ создана на базе открытия А.Ю.Кушелевым в 1992 году композиционного генеического кода https://nano-world-articles.nethouse.ru/articles/314915 






http://nanoworld.org.ru/topic/1150/page/2/ 

В приложении-8 показаны примеры 100 структур белков, которые я определил за 1 рабочий день на одном персональном компьютере. Точность новой технологии (пикотехнологии) в 1000 раз выше точности нанотехнологии, скорость примерно в миллион раз быстрее. Кроме того, Рентгеном можно определять структуры только закристаллизованных белков, а это всего 3%. Остальные не присталлизуются. Для новой технологии такого ограничения нет. По старой технологии за каждую структуру белка в среднем кто-то платит 10 000 евро.




Потенциальные заказчики сообщили, что они смогут заказывать структуры в лаборатории Наномир, если будет официальное разрешение от NCBI. Такой комплект документов может стоить от 100 000 USD. Зато имея это разрешение можно зарабатывать миллион евро в день, имея один персональный компьютер. Приложение-8 с примерами белковых структур можно скачать бесплатно здесь: http://nanoworld.org.ru/topic/1150/











http://nanoworld.org.ru/topic/1453/page/96/

2016.10.14 21:46:18

Формы, механизмы, энергия наномира. Сообщение 80 957

В книге, которую рецензенты советуют использовать как первый учебник по пикотехнологии, в т.ч. белков, показана работоспособность классической физики в масштабах микромира. Нанотехнология против пикотехнологии - что сабля против пулемёта:http://subscribe.ru/archive/science.new … 50955.html

Экономический эффект от внедрения пикотехнологии составит 10^17 евро за десятилетие.




http://nanoworld.org.ru/topic/1150/page/2/ 

В расширенном электронном варианте можно заменить статические иллюстрации на динамические 3D-модели:

http://nanoworld88.narod.ru/data/271_files/0_b0f20_2c87f90a_orig.gif

2016.09.22 14:04:19

Формы, механизмы, энергия наномира. Сообщение 80 546

Вкусная реклама книги "Пикотехнология белков"

Приложение 8.

100 структур в формате PDB, PNG ... https://yadi.sk/d/nWEkBJRdhpP4D

На 2016-09-22 скачано 63 раза.

За каждую структуру по старой технологии заказчики платят в среднем по 10 000 евро.

100 структур, которые я определил за один рабочий день специально для публикации в книге "Пикотехнология белков", обошлись бы заказчикам в миллион евро smile

А список этих 100 белков был составлен Викторией Соколик:


https://img-fotki.yandex.ru/get/9803/158289418.20f/0_129778_35eeac24_orig.png


Вы уже заказали себе бумажный вариант книги "Пикотехнология белков"?

Или Вас устроит электронный вариант, который в 10 раз дешевле?



http://nanoworld.org.ru/topic/1150/ 

Вкусная реклама книги "Пикотехнология белков"

Рецензенты:

д.ф.-м.н. ШУЛЬГА Сергей Михайлович;
д.б.н. БОЖОК Галина Анатольевна

Соколик В.В., Кушелев А.Ю.
С 54 Геометрия живого наномира. Пикотехнология белков / В.В. Соколик, А.Ю. Кушелев. – Харьков: Издательство, 2015. – 255 с.
ISBN 978-3-659-92862-8


Монография посвящена 3D-структуре молекул и полимеров живых систем. Дан анализ современного понимания таких фундаментальных понятий, как физический объём атома, химическая связь, генетический код. На основе статистического анализа экспериментальных данных о структуре белка обосновано кодирование его вторичной структуры и структурного полипептидного шаблона в геноме. Предложена дополненная таблица генетического кода белков и пептидов, которая легла в основу геометрического алгоритма программ декодирования структурного шаблона белка Molecular Constructor и Picotech. Сформулирована гипотеза о перекодировании информации третьего нуклеотида кодона в соответствующий ротамер пептидной связи непосредственно 3D-структурой изоакцепторной тРНК. Математический анализ сопряженности значений углов φ и ψ (карта Рамачандрана) выявил периодичность их изменения, что позволило обосновать механизм посттрансляционного фолдинга белка.
Книга рассчитана на специалистов, занимающихся исследованиями в области молекулярной биологии, биоинформатики, биохимии, биофизики.
Табл.: 36 . Ил.:117 . Библиогр.: 227 назв.


Sokolik VV, Kushelev AY
Geometry live nanoworld. Pikotechnology proteins / VV Sokolik, AY Kushelev. - Kharkov: Publishing, 2015. – 255 p.
ISBN 978-3-659-92862-8
The monograph is devoted to the 3D-structure of molecules and polymers in living systems. The analysis of the modern understanding of the fundamental concepts of the physical volume of the atom, chemical bonding, and the genetic code is presented. Based on statistical analysis of the experimental data on the protein structure is justified coding secondary structure and structural polypeptide template of protein in the genome. Propose additions table of the genetic code of proteins and peptides, which formed the basis of the geometric algorithm software decoding structural template protein, are Molecular Constructor and Picotex. The hypothesis of recoding information to third nucleotide codon in the corresponding peptide bond rotamer directly 3D-structure isoacceptors tRNA is formulated. Mathematical analysis of contingency angles φ and ψ (Ramachandran map) revealed their frequency changes as possible to substantiate the mechanism of post-translational protein folding.
The book is intended for professionals involved in research in the field of molecular biology, bioinformatics, biochemistry and biophysics.
Table: 36. Ill: 117. Refs: 227 titles.


ПРЕДИСЛОВИЕ РЕЦЕНЗЕНТОВ


В 21-м столетии в задаче моделирования нанообъектов таких как атом углерода, органические молекулы, пары комплементарных нуклеотидов и многих других используется кольцегранная модель строения атома. В монографии В.В. Соколик и А.Ю. Кушелева «Геометрия живого наномира. Пикотехнология белков» при помощи кольцегранного подхода к строению атома наглядно (образ – модель) реализуются различные виды, свойства и особенности межатомных взаимодействий, валентные углы в молекулах, разновидности химических связей и их соотношение. Кольцегранная модель реалистично объясняет гибридизацию электронов при формировании химических связей в молекулах, что является краеугольным камнем всей биохимии белкового мира, поскольку атомы углерода в состоянии sp3-гибридизации своих электронов входят в состав скелета аминокислот и таким способом детерминируют углы между химическими связями в их молекулах, а в последующем и в структуре белка в целом.


В монографии В.В. Соколик и А.Ю. Кушелева «Геометрия живого наномира. Пикотехнология белков» сформулирована идея композиционного генетического кода, кодирования ротамерии пептидной связи и структурного шаблона белка. Показано, что в геноме третьим нуклеотидом кодона детерминирован один из трёх ротамерных вариантов пептидной связи, которым аминокислотный остаток (закодированный дуплетом первых двух нуклеотидом кодона) присоединяется к растущей полипептидной цепи. Ротамерный вариант пептидной связи реализуется в процессе синтеза белка в рибосоме и поэтому с неё сходит индивидуальный структурный шаблон белка в соответствие с информацией, содержащейся в его гене. Данный механизм трансляции генетической информации является эволюционно новым. Его формирование у эукариот было обусловлено необходимостью синтеза больших и сложных белков в виде структурного шаблона, максимально приближенного к функциональной конформации этих белков, чтобы их фолдинг имел наибольшие эффективность и однозначность. У прокариот и органелл эукариот третий нуклеотид кодонов в генах небольших полипептидов ещё не является информационным, поэтому на нём и наблюдается воблирование.


Выше изложенные положения легли в основу алгоритма авторских компьютерных программ, которые по нуклеотидной последовательности мРНК позволяют смоделировать схему вторичной структуры и 3D-структуру индивидуального структурного шаблон любого белка. Эту первичную информацию о белке можно использовать в дальнейшем моделировании фолдинга функциональной конформации белка с учетом физ-химии его микроокружения, посттрансляционных модификаций, взаимодействия с лигандами методами молекулярной динамики и доккинга наравне с информацией о наиболее стабильном конформере, которую извлекают из рентгенограмм кристаллов белков. Преимущество данного подхода состоит в возможности быстрого моделирования индивидуальной пространственной структуры отдельной молекулы любого белка с точностью до электрона (пикотехнология), опираясь лишь на информацию о нём в геноме. То есть in silico воспроизводится трансляция генетической информации в индивидуальный структурный шаблон белка. Не исключено, что большинство белков именно из конформации своего структурного шаблона максимально быстро, а главное однозначно, фолдируют в нативную конформацию с минимумом свободной энергии, формиру таким образом «устойчивое большинство» конформационно лабильного белкового пула.


Авторами монографии предложен современный, точный и удобный методологический подход в арсенале молекулярной биологии для моделирования пространственной структуры белков, исходя из той информации генома о них, которой располагает сама клетка.
Итак, перед читателем книга, вводящая в мир идей и результатов, ориентированных на применение в протеомике кольцегранной модели и молекулярный полиморфизм, основанный на структурном разнообразии биомакромолекул. В этой области причудливым и невероятным образом пересекаются достижения многих областей современной науки: физики и химии, биологии и медицины, математики и информатики.


Доктор физико-математических наук С.М. Шульга


В настоящее время моделирование пептидов и белков относится к современным и востребованным методическим подходам, позволяющим не только дополнять, но и порой с успехом заменять условно гуманные эксперименты на лабораторных животных, касающиеся взаимодействия различных биогенных соединений с клеточными структурами. К сожалению, данными подходами владеют немногие естествоиспытатели, успешно работающие в своих областях наук. И в этом случае монография В.В. Соколик и А.Ю. Кушелева «Геометрия живого наномира. Пикотехнология белков» позволяет если не овладеть, то, по крайней мере, понять суть применяемых авторами методов построения моделей белков и их кодирования в геноме. Тем более, что книга очень увлекательно и доступно написана. Достигается эта легкость понимания материала тем, что в монографии четко прослеживается научная логика рассуждений и методических подходов авторов. Читателя знакомят с развитием теории строения атома, как с традиционными уже исторически устоявшимися сведениями, так и с новыми интерпретациями кольцегранной структуры атома и аппроксимации геометрии кольцегранной электронной оболочки архимедовыми телами. Авторы пользуются новой «системой координат», их пикотехнология – это технология электронного уровня, разрешение и точность которой сопоставимы с толщиной закольцованного луча-электрона (пикометр – 10-12 м) в атомах белка. Именно этот подход лежит в основе разработанного авторами геометрического алгоритма определения атомного радиуса.

Одним из важнейших итогов материала монографии В.В. Соколик и А.Ю. Кушелева является реальная возможность с помощью законов геометрии макромира рассчитывать положения атомов в молекуле, не прибегая к квантово-механическим функциям. Такие перспективы обеспечиваются ещё и закономерностями формообразования молекул, которые определены структурой внешних кольцегранных оболочек их атомов, которая, как показано авторами, типична для элементов каждой группы таблицы Менделеева. Сопоставление в монографии экспериментальных данных с представленными моделями протеиногенных аминокислот, рассчитанными геометрическим способом для шаблона многогранных моделей аминокислот, аргументирует убедительность и логичность методологии авторов. Кроме моделей самих аминокислот авторы уточняют способ объединения их в полипептидах, возможность формирования трех видов ротамеров пептидной связи (R, 0 или L-ротамеров), которые интерпретируются авторами в качестве прототипов соответствующих конформеров вторичной структуры в белках.


Через призму теории формирования внешней электронной кольцегранной оболочки атома авторы рассматривают последовательно весь геометрический процесс построения пептидов – от пространственной структуры аминокислот до вторичной конформации и этапов фолдинга белковой молекулы. Логичным фрагментом исследований, изложенных в монографии, является объяснение способа и механизма кодирования и декодирования информации о структурном шаблоне белка в геноме.


Детально охарактеризованы декодированные в программах Molecular Constructor и Picotech В.В. Соколик и А.Ю. Кушелева структурные шаблоны белков в качестве субъектов последующего фолдинга. Представлен количественный сравнительный анализ декодированных структур с соответствующими экспериментальными моделями из базы данных PDB. Особое внимание уделено способам описания пространственной структуры белка и характеристике элементов вторичной структуры, а также современным методам моделирования in silico.


Следует отметить, что данная монография актуальна не только как научный труд. Собственный интерес авторов к своей работе заражает, более чем полный массивный объем информации, увлекательная и яркая форма ее изложения и оформления делает монографию применимой также и в качестве учебника для студентов естественнонаучных специальностей, особенно таких, как биохимия, биофизика и биотехнология.


Доктор биологических наук Г.А.Божок




Вкусная реклама книги "Пикотехнология белков"

Здравствуйте.
Меня интересует вопрос, зачем при репликации удаляются праймеры? Я понимаю что это кусок рнк, был создан для начала репликации, но ведь он полностью совпадает с родительской цепочкой ДНК, зачем удалять эти нуклеотиды и вставлять такие же?


Это связано с механизмом репликации. В процессе эволюции возник механизм, который работает через удаление с последующим восстановлением.


Аналогичный механизм используется для реализации композиционного генетического кода. Это механизм трансляции: http://nanoworld88.narod.ru/data/227.htm


http://nanoworld88.narod.ru/data/227_files/0_4829f_ebf358c0_XL.png


тРНК подплывает к рибосоме антикодоновым концом и ... срезает триплет иРНК, который находится на сайте трансляции. При этом тРНК продолжает вращаться:

http://img-fotki.yandex.ru/get/5706/nanoworld2003.28/0_4f335_3e755a19_S.gif


По инерции тРНК может повернуться больше, чем на 360 градусов, но третье азотистое основание срезанного триплета тРНК останавливается раньше, встретив комплементарное основание композиционного сайта рибосомальной РНК. Так кодируется угол поворота аминокислоты, которая вращается вместе с тРНК на ССА-конце:


http://img-fotki.yandex.ru/get/9223/483405.21a/0_82497_9f79885f_S.gif


После установки аминокислоты под закодированным углом в растущую структуру белка триплет иРНК возвращается на место, и восстановленная структура иРНК продвигается на один триплет к выходу из рибосомы.


При репликации работает аналогичный механизм, который удаляет праймер. Этот праймер в отрезанном виде выполняет некую функцию, после чего надо вернуть его или его копию на место.


В 2015-ом году опубликована статья, в которой показан результат сканирования поверхности атомов с помощью АСМ (атомного силового микроскопа). Этот эксперимент подтвердил модельные эксперименты, которые привели к созданию пикотехнологии, в т.ч. белков:http://subscribe.ru/archive/science.new … 14532.html


https://img-fotki.yandex.ru/get/15543/158289418.21b/0_12dd37_2a26bec2_orig.jpg


Понятно, что это научное направление будет развиваться и поможет проследить работу не только механизма трансляции, но и механизма репликации во всех подробностях.


Вам может очень пригодиться книга "Пикотехнология белков":


https://img-fotki.yandex.ru/get/6744/158289418.210/0_129786_b903f572_orig.png






ПЕРЕПИСКА С МЕНЕДЖЕРОМ
[21:01:05] Andrei: кстати ответ про отличие точности с нано не дан до конца
[21:01:21] Andrei: непонятно что измеряется в нано
[21:01:30] Andrei: молекулы?
[21:03:32] Andrei: есть ли конкретно две картинки одного и того же в нано и пико?
[21:03:40] Andrei: но чтобы рядом было
[21:03:42] Кушелев Александр Юрьевич: В нанометрах можно измерять и размеры атомов, молекул, и длины волн. А пикометр 10^-12 отличается от нанометра 10^-9 в 1000 раз
[21:04:44] Кушелев Александр Юрьевич: Здесь есть сравнение нанотехнологических моделей с пикотехнологическими: http://nanoworld88.narod.ru/data/212.htm
[21:05:21] Andrei: а есть две картинки рядом чтобы было понятно людям?
[21:09:22] Кушелев Александр Юрьевич:

http://nanoworld88.narod.ru/data/212_files/0_48888_9c8642fd_orig.gif

http://nanoworld88.narod.ru/data/212_files/0_48ad1_768200e6_L.png



[21:09:54] Кушелев Александр Юрьевич: Верхняя картинка - нано, нижняя - пико
[21:10:44] Andrei: то есть нижняя картинка должны быть точкой на верхней, так?
[21:10:52] Andrei: и где эта точка?
[21:11:10] Andrei: почему нужно гадать?
[21:13:40] Кушелев Александр Юрьевич: На нижней картинке пико-точность, там видно в 1000 раз больше деталей.
[21:14:05] Кушелев Александр Юрьевич: Каждое колечко на нижней картинке - электрон. На верхней Вы электронов вообще не видите
[21:14:18] Кушелев Александр Юрьевич: Как, впрочем и целых атомов.
[21:14:32] Andrei: а что видно на верхней? как это называется?
[21:14:32] Кушелев Александр Юрьевич: На верхней картинке Вы видите только символическое изображение альфа-спиралей
[21:14:46] Andrei: хорошо, сейчас понятно
[21:18:23] Andrei: кстат и там 2 нано картинки в чем отличие?
[21:19:34] Кушелев Александр Юрьевич: Вы отличие видите?
[21:20:07] Andrei: да, спирали отличаются
[21:20:55] Кушелев Александр Юрьевич: ОК
[21:20:56] Andrei: вверху цветные и более растянутые
[21:21:21] Andrei: какая картинка правильней?
[21:22:53] Andrei: эти картинки сделаны в разных программах или что?
[21:23:47] Andrei: надпись на английском относится к верхней картинке?
[21:23:56] Andrei: или к нижней?
[21:25:11] Andrei: просто не хочется путать людей если спросят
[21:26:40] Andrei: по логике могу лишь сделать гадание что верхняя картинка это программа сделала а внизу видимо снимок
[21:26:50] Andrei: так?
[21:28:19] Andrei: кстати про разницу между терминами нано и пико объяснено за путанно, можно проще объяснить
[21:29:00] Andrei: это и так ясно что разница в 3 порядка и без объяснений
[21:30:12] Кушелев Александр Юрьевич: Все картинки сделаны в программах.
[21:30:53] Andrei: было бы неплохо это подписать для достоверности
[21:31:41] Andrei: там написано снимок с микроскопа, это тоже программа?
[21:32:30] Кушелев Александр Юрьевич: Изображения из под микроскопов - результат компьютерной обработки неких данных
[21:33:00] Andrei: хорошо, внизу данные из микроскопа а вверху откуда?
[21:33:47] Andrei: или это те же данные но в разных программах?
[21:35:51] Кушелев Александр Юрьевич: Мои данные из программы Пикотех.
[21:36:11] Кушелев Александр Юрьевич: Нанотехнологические данные - результат компьютерной обработки данных РСА
[21:37:18] Andrei: то есть Пикотех и нанокартинки строит?
[21:38:15] Andrei: кстати на пикокартинке не видны спирали отчетливо
[21:38:34] Andrei: так, как на нанокартинке
[21:39:00] Andrei: как так?
[21:41:00] Кушелев Александр Юрьевич: Программа Пикотех выдаёт стандартный файл с координатами атомов, по которому стандартные браузеры построят всё по нанотехнологическому стандарту. Но дополнительно выдаёт и более детальную информацию, т.е. может показать все электроны. Нанотех электроны показать не может. Да и атомы показывает не там, где они есть...
[04.12.2016 21:41:38] Andrei: так, хорошо, это я запишу себе для людей
[04.12.2016 21:43:14] Andrei: уже проясняется
[04.12.2016 21:46:25] Andrei: а такой вопрос - если два белка столкнуть вместе рядом - в этом есть какой-то смысл?
[04.12.2016 21:46:43] Andrei: бывает ли такое в реальности?
[04.12.2016 21:47:15] Andrei: как белки взаимодействуют между собой и окружающим веществом?
[04.12.2016 21:48:41] Andrei: там спирали сталкиваются ли на уровне атомов происходит взаимодействие?
[04.12.2016 22:44:02] Кушелев Александр Юрьевич: На этот вопрос даже Гугл знает ответ
[8:15:39] Andrei: http://chem21.info/info/32732/
[8:15:46] Andrei: вот что нашел
[8:17:19] Andrei: кстати а может программа расчитать четвертичную структуру?
[8:17:28] Andrei: http://www.agromage.com/stat_id.php?id=720
[11:17:21] Кушелев Александр Юрьевич: Существующая версия программы Пикотех определяет только вторичную и третичную структуры белка, причём такими, какими их делает рибосома.
[11:19:10] Andrei: А на картинке написана четверичная структура
[11:20:37] Andrei: гистон 5
[11:20:48] Andrei: там где спирали
[11:20:51] Andrei: как так?
[11:21:02] Andrei: или это опечатка?
[11:22:14] Кушелев Александр Юрьевич: Четвертичную структуру я могу определять лишь вручную
[11:22:35] Andrei: а они как сделали?
[11:23:43] Andrei: в этом их программа сильней?
[11:27:02] Кушелев Александр Юрьевич: Четвертичную структуру хорошо показывает РСА. Более того, её можно иногда увидеть даже в микроскоп smile
[11:28:52] Кушелев Александр Юрьевич: Программа Пикотех моделирует работу рибосомы, а рибосома делает только третичную структуру. Как потом соберутся субъединицы белков  четвертичную структуру, определяет физико-химическое взаимодействие. И это не очень сложная задача, т.е. как собрать домик из блоков известной формы.
[11:29:57] Кушелев Александр Юрьевич: Наиболее востребована именно третичная структура, которая собирается программой Пикотех автоматически. Именно эти результаты Пикотех я и предлагаю делать на заказ. Всё остальное не так эффективно.




Инвестирование, лицензии, менеджемент, продвижение, представительство

Работа с менеджером по нескольким научным направлениям     1   2   3   4   5   6   7





Конкурс CASP December 2017

http://nanoworld.org.ru/topic/1150/page/3/   2016.10.12 22:26:13  

Формы, механизмы, энергия наномира. Сообщение 80 867

Victoriy пишет:

Приглашение на очередную 12-ю CASP конференцию (на этот раз в Италии) December 10-13th 2016, Gaeta (Italy)
Правда регистрационный взнос в 1000 евро и это без дороги -- кусается smile.

CASP: Early bird registration deadline for the CASP12 meeting is October 10th
A reminder that the deadline for early bird registration for the CASP12 meeting in Gaeta is now very close - next Monday October 10th.

The second planning meeting, in which the assessors present their preliminary findings to the organizers, was held a couple of weeks ago, and there is some pretty exciting stuff. In particular, looks like substantial improvement in average "new fold" model accuracy, probably due to the new co-evolution methods. The new "is the model as good as experiment for understanding function" category has a team of four assessors, led by Russ Altman, and should produce substantial insights. Very intriguing comparisons between SAXS data, experimental structures, and models. Again we have a collaboration with CAPRI for modeling assemblies, with a more substantial body of data than previously. And, of course, many interesting results in comparative modeling, refinement, and accuracy estimation.

Registration: http://www.cevs.ucdavis.edu/confreg/ind … webid=4026

Specifics of the travel arrangements:
http://predictioncenter.org/casp12/meet … ctions.cgi

Additional information:

12th CASP Meeting
December 10-13th 2016, Gaeta (Italy)

The meeting concludes the 12th international CASP (Critical Assessment of Techniques for Protein Structure Prediction) experiment. The goal of the meeting is to discuss the state of the art of methods for predicting protein structure, assembly, and function from sequence, reporting and discussing the results of a blind assessment.


Confirmed invited speakers:
Russ Altman - Stanford University - USA
Alexandre Bonvin - Utrecht University - NL
Guido Capitani - Paul Scherrer Institut - CH
Matteo Dal Peraro - Ecole Polytechnique Federale de Lausanne - CH
Edward H. Egelman - University of Virginia - USA
Francesco Gervasio - UCL - UK
Michael Levitt - Stanford University - USA

Location

The meeting will be held at Hotel Serapo (www. http://www.hotelserapo.com/en/), on the slopes of the Natural Park of Monte Orlando in a beautiful and panoramic corner overlooking Serapo Beach, very close to the city center and the old town of Gaeta.

The city itself, the so-called Ulysses Riviera, is embedded in a fascinating area, full of surprises, natural beauties, history, art and culture. It is conveniently located between Rome and Naples. It overlooks the Tyrrhenian Sea. Its history as a resort dates back to Imperial Rome. Nearby sites include the first-century BC mausoleum of general Lucius Munatius Plancus. Its old town is mostly medieval, showcased by narrow alleys, the massive 13th-century castle and the 12th-century Cathedral of Assunta e Sant"Erasmo.


Registration details:
Deadline for early bird registration: October 10th, 2016
Deadline for late registration: November 14th, 2016

Registration fees (***):
Separate room Shared room
Early bird registration US$ 975 / ~850 Euro US$ 870 / ~750 Euro
Late registration US$ 1,125 / ~1000 Euro US$ 1,020 / ~900 Euro
Accompanying person (*) US$ 340 / ~300 Euro
Extra day before or after the meeting (**): US$ 90 / ~80 Euro per person

(*) Includes accommodation and full board for the period of the conference and Gala Dinner.
(**) Includes accommodation and full board.
(***) Depending on the resources available, some students might be entitled to receive a partial refund of the registration fee. Eligible registered applicants will be contacted after the early registration deadline. The amount of reimbursement will depend upon available financial resources.


Кушелев: Я бы очень хотел, чтобы Виктория Соколик, богиня пикотехнологии (а теперь ещё и богиня вечной молодости!) сделала доклад на конференции CASP. Ведь после создания пикотехнологии нанотехнология безвозвратно устарела. Это значит, что все, кто сегодня вкладывают в устаревшую нанотехнологию, выбрасывают деньги на ветер, а могли бы вложить в современную пикотехнологию и поднять нашу цивилизацию на новую ступень развития.


https://img-fotki.yandex.ru/get/58675/158289418.356/0_1613ab_1d664fd2_XL.jpg


Структура белка 1VOL. Совмещение с ДНК в Пикософте и PDB

Вводная часть 1 , 2 

Начало работы. Пикотехнологические модели двух частей комплекса 1VOL

https://nano-world-articles.nethouse.ru/articles/326755 


Кушелев: В комплексе 1VOL не две одноцепочечные РНК, а двойная спираль из 16 ступеней:

http://www.rcsb.org/pdb/pv/pv.do?pdbid= … ionumber=1

https://img-fotki.yandex.ru/get/143188/158289418.3a4/0_16d2b6_acc24aaa_XL.jpg



https://img-fotki.yandex.ru/get/196534/158289418.3a4/0_16d2d1_5547f72d_XL.png
Так выглядят две субъединицы ДНК из комплекса 1VOL

Можно более или менее красиво изобразить пикотехнологическую модель ДНК изолированными атомами.

https://img-fotki.yandex.ru/get/198303/158289418.3a4/0_16d2d5_72f71711_XL.png
Так в программе Hyperchem изображаются атомы азотистого основания гуанина. В принципе сносно.

Осталось добавить координаты атомов рибозы и фосфатной группы. А дальше дублировать нуклеотид, поворачивать и смещать на вектор, который можно взять из скрипта-конструктора ДНК.


Формы, механизмы, энергия наномира. Сообщение 83 020

http://nanoworld88.narod.ru/data/237_files/0_4dfa5_6905ee99_L.png

Удалось вписать в PDB файл координаты атомов азотистого основания (гуанина) и рибозы.

https://img-fotki.yandex.ru/get/196548/158289418.3a4/0_16d2d6_5e30d730_XL.png
Программа Hyperchem показывает атомы углерода светло-голубыми кружочками, атомы азота - синими, а атомы кислорода - красными. Верхний атом кислорода находится ближе к нам, чем плоскость азотистого основания, а два других - дальше. Все остальные атомы лежат в плоскости азотистого основания.                                        

Осталось добавить атом фосфора и три атома кислорода, чтобы завершить модель нуклеотида.
После этого можно будет его дублировать, поворачивать и смещать на вектор, который можно позаимствовать из скрипта "Конструктор ДНК/РНК"

Координаты атомов для файла PDB были взяты по этой разметке:

https://img-fotki.yandex.ru/get/176331/158289418.3a4/0_16d2d7_674cdb88_XL.jpg
Оригинал: https://img-fotki.yandex.ru/get/176331/ … 8_orig.jpg


Формы, механизмы, энергия наномира. Сообщение 83 022

https://img-fotki.yandex.ru/get/42692/158289418.3a5/0_16d2d8_bcc25a22_XL.png 
Координаты для PDB-файла определены.

https://img-fotki.yandex.ru/get/114758/158289418.3a5/0_16d2d9_cd41f6c9_XL.png
Модель нуклеотида (гуанинмонофосфата) готова.                       
            

Теперь осталось построить 16 звеньев одноцепочечной РНК, дублируя, поворачивая и сдвигая на известный вектор модель одного нуклеотида.

Осталось найти программу, в которой удобно ввести PDB-файл с моделью нуклеотида, скопировать, сдвинуть и повернуть. Кстати, этот вектор нужно умножить на согласующий коэффициент, т.к. модель нуклеотида собрана в другом масштабе...

В скрипте "ДНК-конструктор" радиус кольца-электрона задавался равным 4.8, а в PDB радиус равен 0.7. Соответственно вектор и точка привязки должны быть умножены на коэффициент 0.7/4.8=0,1458333

В программе PyMol вроде можно было задать вращение и перемещение численно. А если не получится, то записать в виде скрипта для 3DS Max, построить модель ДНК и вывести в виде файла координат. После чего добавить координаты в PDB-файл.

Кстати, классная плоская модель нуклеотида получится. Всего 23 вершины тонкой фигуры. Надо посмотреть, как будет выглядеть. Очень компактное графическое представление...


https://img-fotki.yandex.ru/get/4208/158289418.3a5/0_16d2fb_b5dfb41_XL.pnghttps://img-fotki.yandex.ru/get/54522/158289418.3a5/0_16d2fc_ef7f19ee_XL.png

Плоская модель нуклеотида, где вершинами являются выступающие ядра атомов, смотрится очень необычно...

Анимация: https://cloud.mail.ru/public/JXhm/Qz6NrbsRq


Построить на базе этой модели нуклеотида структуру одноцепочечной РНК - не проблема. Завтра мы с этого и начнём...

Плоские модели нуклеотидов могут очень пригодиться для моделирования гигантских РНК типа рибосомальной. Это очень компактное представление, в котором все ядра атомов могут быть установлены идеально.


Модель одноцепочечной РНК, состоящей из 16 нуклеотидов: https://cloud.mail.ru/public/69Aq/DxC1qoVho


На этой модели заметно, что на один оборот спирали приходится не 10, а 6 оснований ДНК. При шаге спирали 34 ангстрема на каждую ступень приходится 34/6 =5.67 ангстрема. По общепринятой версии на каждую ступень приходится 34/10=3.4 ангстрема. Это связано с неправильной настройкой угла между нуклеотидами.

http://nanoworld88.narod.ru/data/236_files/0_4e1a8_e8302c5f_M.gif
Позднее в процессе настройки я получил параметры, которые соответствуют данным РСА, т.е. 10 нуклеотидов на виток ДНК.

Так что углы поворота придётся подправить...


Формы, механизмы, энергия наномира. Сообщение 83 027

https://img-fotki.yandex.ru/get/197700/158289418.3a5/0_16d39e_b0e61ab7_XL.png


анимация: https://cloud.mail.ru/public/2dCq/DYkHq7aJt


Теперь оформим эти координаты в виде PDB-файла.


Но лучше сделать PDB-файл сразу для двухцепочечной РНК. Ведь удалить одну цепочку легко.


Анимация: https://cloud.mail.ru/public/3HLS/tEqiBm5wW


https://img-fotki.yandex.ru/get/149179/158289418.3a5/0_16d433_eca89796_XL.png


https://img-fotki.yandex.ru/get/171750/158289418.3a5/0_16d435_17477518_XL.png

https://img-fotki.yandex.ru/get/171750/158289418.3a5/0_16d436_22715fdf_XL.png

Понятно, что для 16 ступеней двухцепочечной ДНК PDB файл желательно сформировать с помощью скрипта для 3DS Max.


Skype, 2016-12-17:

[20:19:39] Кушелев Александр Юрьевич: Привет, Валентин!
[20:19:54] Кушелев Александр Юрьевич: Может сохранить из скрипта PDB-файл?
[20:19:56] Кушелев Александр Юрьевич: http://nanoworld.org.ru/post/80451/#p80451
[20:20:26] Кушелев Александр Юрьевич: Есть образец для 1 из 32 кусков, сделанный вручную
[20:22:20] Кушелев Александр Юрьевич: Правда, по образцу можно сделать 16 кусков PDB-файла, а другие 16 кусков на пару атомов меньше, поэтому я сделаю для них второй образец.
[20:25:56] Кушелев Александр Юрьевич: Второй образец отличается тем, что там отсутствует 14-й и 16- атомы из первого образца.
[20:28:25] Кушелев Александр Юрьевич: PDB-файл, который ты выведешь из скрипта, можно послать американскому заказчику, чтобы он вставил модель РНК в белковый комплекс. Если вставится, то это - победа пикотехнологии.
[20:29:16] Кушелев Александр Юрьевич: А если мы сами присобачим модель РНК к моделям белков, то можно будет опубликовать научную статью и подать на нобелевскую smile


 ПИКОМЕХАНИКА тРНК

 МОДЕЛЬ ФРАГМЕНТА ЛИЗОЦИМА

 МОДЕЛЬ ГИСТОННОГО КОМПЛЕКСА

 КОМПОЗИЦИОННЫЙ КОД


Skype, 2016-12-18:

[15:26:25] Кушелев Александр Юрьевич: Образец PDB-файла для одной ступени РНК/ДНК: http://nanoworld.org.ru/post/80481/#p80481
[15:27:46] Кушелев Александр Юрьевич: Нужно по этому шаблону сделать файл для 16 ступеней по этим координатам: http://nanoworld.org.ru/post/80451/#p80451
[15:28:50] Кушелев Александр Юрьевич: Это можно было бы сделать вручую в программе типа "Волков командер", где можно стоблцами оперировать. Но у меня эта программа не установлена...
[15:42:05] Va12220(valqwa): Саша, привет!
попробую. сегодня до вечера
[15:43:05] Кушелев Александр Юрьевич: Благодарю!
[15:51:14] Кушелев Александр Юрьевич: Интересно сделать вывод файла именно из скрипта, чтобы в будущем выводить такие файлы для РНК/ДНК и комплексов "белок-РНК/ДНК"


Victoriy

А.Ю., ещё раз сделала модели нуклеотидов и модель двух комплементарных пар А=Т и G=С
https://img-fotki.yandex.ru/get/102077/417565639.0/0_11b84a_45a92796_orig.jpg


Кушелев: Класс! Благодарю!

Что касается комплекса 1VOL, то там двухцепочечная ДНК, а я делаю модели РНК, т.к. из них ДНК получаются исключением OH групп.



[0:19:33] Va12220(valqwa): все. спать? )

https://img-fotki.yandex.ru/get/174613/158289418.3a5/0_16d601_4c2be31a_XL.png

https://img-fotki.yandex.ru/get/196183/158289418.3a5/0_16d602_93747e0b_XL.png

https://img-fotki.yandex.ru/get/174613/158289418.3a5/0_16d603_ed6fe55c_XL.png

https://img-fotki.yandex.ru/get/194425/158289418.3a5/0_16d604_58b8c191_XL.png

[0:19:57] Кушелев Александр Юрьевич: Класс!

[0:20:29] Va12220(valqwa): долго ли умеючи, ну смотри. делай выводы и поправки. пиши мне их.
[0:20:32] Кушелев Александр Юрьевич: А как ты оцениваешь сложность задачи показать все возможные точки роста молекулы белка?
[0:20:55] Кушелев Александр Юрьевич: На первом шаге 3 точки, на втором 9 и т.д.
[0:21:09] Va12220(valqwa): если ты дашь определение "точек роста молекулы белка" - то как обычную задачу
[0:21:42] Кушелев Александр Юрьевич: Ну помнишь задачу, где треугольник перемещался по трём вариантам?
[0:21:55] Кушелев Александр Юрьевич: Центр треугольника нужно изобразить точкой
[0:22:04] Кушелев Александр Юрьевич: От неё три точки
[0:22:09] Va12220(valqwa): скорее не помню. записи остались. по ним вспомню. когда найду )
[0:22:13] Кушелев Александр Юрьевич: От каждой следующей опять три точки
[0:22:48] Кушелев Александр Юрьевич: Вот алгоритм: .............

[0:23:13] Кушелев Александр Юрьевич: Но здесь по композиционному коду строится конкретная модель белка
[0:23:29] Кушелев Александр Юрьевич: Каждый аминокислотный остаток изображается многогранником
[0:23:39] Кушелев Александр Юрьевич: Подробнее: http://nanoworld88.narod.ru/data/263.htm
[0:23:43] Кушелев Александр Юрьевич: А нам нужно точкой
[0:24:16] Кушелев Александр Юрьевич: И чтобы на каждом шаге было показано не одна точка, а три, т.е. показаны все варианты композиции
[0:24:31] Кушелев Александр Юрьевич: На каждом шаге должно быть "дробление на три"
[0:24:50] Кушелев Александр Юрьевич: Точки должны утраиваться на каждом шаге алгоритма
[0:25:22] Кушелев Александр Юрьевич: Мы должны увидеть все варианты роста белка сразу
[0:25:34] Кушелев Александр Юрьевич: На первом шаге 3 варианта в виде 3 точек
[0:25:45] Va12220(valqwa): да можно все сделать. вот только уже не сейчас. сейчас - спать )


Татьяна Рясина пишет:

А чем вообще сегодня с учётом современных возможностей можно как следует до атома увидеть молекулы белков? Чтобы таки сопоставить 3D визуализацию по методу Пикотеха и данные экспериментов? Что вообще может прийти на смену РСА?

Кушелев: Кольцевые грани атомов удалось увидеть с помощью АСМ в 2014-ом году: http://nanoworld88.narod.ru/data/493.htm

Однако прощупывать молекулы белков таким способом очень трудоёмко. Я предполагаю, что раньше смогут определить формы некоторых молекул, например, азотистых оснований. Когда увидят, что атомы в азотистых основаниях расположены в шахматном порядке, ситуация снова резко изменится. Ведь во всех базах типа PDB сегодня формы молекул неправильные даже на уровне топологии, не говоря о форме.

После подтверждения формы ступени ДНК с помощью АСМ пикотехнологию будут воспринимать серьёзно.


[18.12.2016 22:00:47] Andrei: пришел ответ от доктора
[18.12.2016 22:01:31] Andrei: у Соколик лучше результат
[18.12.2016 22:01:37] Andrei: ближе к РСА
[18.12.2016 22:03:33] Кушелев Александр Юрьевич: Она к этому и стремилась.
[18.12.2016 22:04:04] Кушелев Александр Юрьевич: А можно посмотреть на этот ответ целиком?
[18.12.2016 22:04:38] Andrei: I used the models of PDB files to align with the experimental structure in the PDB.
For Kushelev model and 1volA the RMSD was 18 Angstrom (please see figure attached)

https://img-fotki.yandex.ru/get/110545/158289418.3a5/0_16d5f2_261f4f43_XL.png
For Sokolik TFIIB_204 model and 1volA the RMSD was 16.5 Angstrom
Finally for the alignment of of TFIIB and TFIIB_204  the RMSD was 18 Angstrom.
I used the Pymol software to calculate the alignments.
I wonder whether there is explanation to those results or I miss something.
In addition the sequence of TFIIB 1volA is attached in FASTA file just to make sure the the structural models are based on this specific sequence.
[18.12.2016 22:08:42] Кушелев Александр Юрьевич: Нужна последовательность FASTA и рисунки, вложенные в письмо
[18.12.2016 22:08:42] Andrei: еще есть файлы
[18.12.2016 22:08:49] Кушелев Александр Юрьевич: Давайте их посмотрим
[18.12.2016 22:09:13] Кушелев Александр Юрьевич: 18 анстрем - неплохо для РСА smile
[18.12.2016 22:09:56] Andrei: так 2А пишут в базе
[18.12.2016 22:10:07] Andrei: технология улучшилась
[18.12.2016 22:10:14] Кушелев Александр Юрьевич: Там можно и 0.002А написать. Вы тоже поверите? smile
[18.12.2016 22:10:45] Andrei: это официальная база, если обманут то это уголовное дело
[18.12.2016 22:10:55] Andrei: никто с этим не будет связываться
[18.12.2016 22:11:06] Andrei: там и репутация автора
[18.12.2016 22:11:31] Andrei: это не совок что кто что хочет то и пишет так как ответственности нет
[18.12.2016 22:11:55] Andrei: послал
[18.12.2016 22:11:59] Кушелев Александр Юрьевич: Вы же видели, что в 2012-ом году "обман" уменьшился на 3% по сравнению с 2010-ым годом smile
[18.12.2016 22:13:11] Кушелев Александр Юрьевич: Давайте лучше файлы посмотрим.
[18.12.2016 22:13:17] Andrei: послал говорю
[18.12.2016 22:13:26] Кушелев Александр Юрьевич: По почте?
[18.12.2016 22:13:30] Andrei: да

>1VOL:A PDBID CHAIN SEQUENCE
AMMNAFKEITTMADRINLPRNKVDRTNNLFRQAYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEI
CAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRS
PISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL

https://img-fotki.yandex.ru/get/113457/158289418.3a5/0_16d609_3d4263d7_S.gifhttps://img-fotki.yandex.ru/get/196237/158289418.3a5/0_16d60a_3625c753_S.pnghttps://img-fotki.yandex.ru/get/25921/158289418.3a6/0_16d60b_9c743780_S.gifhttps://img-fotki.yandex.ru/get/52656/158289418.3a5/0_16d60c_15c020fe_S.pnghttps://img-fotki.yandex.ru/get/170627/158289418.3a5/0_16d60d_315640ab_S.pnghttps://img-fotki.yandex.ru/get/113457/158289418.3a5/0_16d60e_8e13985e_S.pnghttps://img-fotki.yandex.ru/get/128227/158289418.3a5/0_16d60f_48fec44f_S.pnghttps://img-fotki.yandex.ru/get/170627/158289418.3a6/0_16d611_c9eb8bdd_S.gifhttps://img-fotki.yandex.ru/get/131711/158289418.3a5/0_16d612_dd6f0fc6_S.pnghttps://img-fotki.yandex.ru/get/194541/158289418.3a6/0_16d613_a53c7691_S.gifhttps://img-fotki.yandex.ru/get/102548/158289418.3a5/0_16d614_7464e284_S.pnghttps://img-fotki.yandex.ru/get/52656/158289418.3a6/0_16d615_19b5db72_S.pnghttps://img-fotki.yandex.ru/get/102077/158289418.3a6/0_16d616_617e6a39_S.pnghttps://img-fotki.yandex.ru/get/49312/158289418.3a6/0_16d617_260b955d_S.png

[18.12.2016 22:14:15] Andrei: забыл тот ответ - так почему днк должно войти в белок?
[18.12.2016 22:20:35] Кушелев Александр Юрьевич: Комплекс 1VOL - это две белковые молекулы, которые читают ДНК, поэтому структура белковых молекул должна быть согласована со структурой ДНК.
[18.12.2016 22:21:08] Кушелев Александр Юрьевич: РСА показывает, что ДНК проходит внутри белковых молекул. Но деталей не показывает.
[18.12.2016 22:21:35] Кушелев Александр Юрьевич: Если мы сделаем правильные пикотехнологические модели белков и ДНК, то увидим, как они сопрягаются на уровне пикометров.
[18.12.2016 22:22:00] Кушелев Александр Юрьевич: А реальная точность моделей, построенных по данным РСА - десятки-сотни ангстрем.
[18.12.2016 22:22:04] Andrei: когда это будет готово?
[18.12.2016 22:22:55] Кушелев Александр Юрьевич: Если сегодня Валентин сможет вывести PDB-файл молекулы ДНК, то сегодня же можно и попробовать совместить модель ДНК с моделями белков
[18.12.2016 22:23:53] Andrei: щас тогда напишу ей интересно ли ей это направление
[18.12.2016 22:24:46] Andrei: или лучше подождать?
[18.12.2016 22:24:53] Andrei: а то вдруг не сойдется
[18.12.2016 22:24:56] Кушелев Александр Юрьевич: Вы можете написать, что нам интересно построить полную модель комплекса, т.е. proteins + DNA
[18.12.2016 22:25:24] Кушелев Александр Юрьевич: Лучше немного подождать. Нужно проанализировать то, что она написала.
[18.12.2016 22:25:28] Andrei: ага


Skype, 2016-12-19:

[2:47:17] Кушелев Александр Юрьевич: PDB-файл ДНК готов: http://nanoworld.org.ru/topic/1530/page/9/
[8:52:08] Andrei: нужно к нему описание
[8:52:35] Andrei: что сделано и что хотим показать этим
[9:13:14] Кушелев Александр Юрьевич: Нужно сделать модель всего комплекса. Вот тогда будет что показать на Нобелевскую smile


https://img-fotki.yandex.ru/get/110545/158289418.3a5/0_16d5f2_261f4f43_XL.png
Кушелев: Я так понял, что это сопоставление моей модели TFIIB с моделью из PDB

https://img-fotki.yandex.ru/get/194425/158289418.3a4/0_16b9a6_dd58245_XL.png
Модель комплекса из PDB


 ПИКОСОФТ СТАТЬИ, ПЕРЕПИСКА С CASP


[15:39:17] Кушелев Александр Юрьевич: Несколько кадров из анимации комплекса TBP1+DNA (электронный слой): http://nanoworld.org.ru/post/80544/#p80544

https://img-fotki.yandex.ru/get/40987/158289418.3a6/0_16d6d0_30af59fd_XL.pnghttps://img-fotki.yandex.ru/get/195990/158289418.3a6/0_16d6d1_ceac4eda_XL.pnghttps://img-fotki.yandex.ru/get/166616/158289418.3a6/0_16d6d2_b69904ab_XL.png

https://img-fotki.yandex.ru/get/30536/158289418.3a6/0_16d6d4_bf1a6764_XL.pnghttps://img-fotki.yandex.ru/get/30536/158289418.3a6/0_16d6d5_fe0d18a7_XL.pnghttps://img-fotki.yandex.ru/get/40987/158289418.3a6/0_16d6d6_44df52a6_XL.png

[15:44:34] Кушелев Александр Юрьевич: Тут ещё есть любопытный момент. В банке PDB в комплексе 1VOL показана общепризнанная, но неправильная модель ДНК. Там показаны 16 ступеней ДНК. В пикотехнологической модели комплекса TBP1+DNA (электронный слой) видно, что в белок входит фактически 2 (максимум 3) ступени ДНК. Таким образом можно констатировать факт, что по данным РСА размер ДНК определён с погрешностью типа 400%. Абсолютная ошибка превышает 10 ангстрем в длину участка ДНК.



Victoriy

Ещё один момент: АЮ не торопитесь с обнародыванием своей модели ДНК, Вы точно отпугнёте заказчицу. Если с белками как говориться бабушка на двое сказала: у каждого своя конформация, которая ещё может и видоизменяться в процессе функционирования. То в структуре ДНК не сомневается ни один биолог и Вам на слово никто не поверит. Кстати с Вашей "новой" моделью ДНК я тоже не могу согласиться.
Не надо загружать заказчика Вашими подробностями и трудностями. Сейчас модели белков, нуклеиновых кислот, лигандов вручную никто не совмещает (это дилетантство), обычно используют метод виртуального молекулярного докинга. (дружеский совет во благо)


Victoriy

Вопрос к А.Ю.: Ваш файл pdb для нуклеотидной последовательности соответствует общепринятой последовательности атомов в нуклеотиде? Если да, то я буду тоже ориентироваться на данную нумерацию и последовательность атомов, если Вы не сверяли, то это придётся уточнять для однозначного воспроизведения координатных файлов нуклеиновых кислот вьюерами.


Victoriy пишет:

Вопрос к Андрею: Вы порекомендовали заказчице покрутить мои модели в Молекулярной Динамике? Мне кажется, что после такой процедуры сходство с моделями, построенными по данным РСА, должно стать ещё больше.

Предложение для А.Ю. и Андрея: посмотрите в архиве Наномира мои публикации по пикотехнологии (там и про углы, и про карты Рамачандрана, и что самое главное на языке биологии).

Кушелев: Самое лучшее - это книга "Пикотехнология белков". Андрей хочет прочитать эту книгу.


Формы, механизмы, энергия наномира. Сообщение 83 096

Victoriy пишет:

Сейчас модели белков, нуклеиновых кислот, лигандов вручную никто не совмещает (это дилетантство), обычно используют метод виртуального молекулярного докинга. (дружеский совет во благо)

Кушелев: Отлично! Значит достаточно передать заказчику PDB-файлы белков и ДНК, и метод молекулярного докинга сделает своё дело.

Что касается

Victoriy пишет: Вашей "новой" моделью ДНК я тоже не могу согласиться.

то эта модель ДНК была создана в 2011 году. Сегодня я планирую создать окончательный PDB-файл двухцепочечной пикотехнологической модели РНК / ДНК (ядерный слой), который можно будет отослать заказчику для совмещения с моделями белков комплекса 1VOL.

Как видите, в среде 3DS Max модель ДНК идеально совместилась с моделью белка TBP1. Кстати, Вы тоже можете попробовать совместить Ваши модели белков и ДНК. Вдруг они у Вас тоже идеально совместятся smile

https://img-fotki.yandex.ru/get/194425/158289418.3a6/0_16d75b_ac62a198_XL.png
Анимировать: https://cloud.mail.ru/public/Ft3F/o4v8jS5ov

Совмещение пикотехнологической модели ДНК (ядерный слой) с пикотехнологической моделью белка TBP1. Отчётливо видно сопряжение на уровне трёх ступеней ДНК.

https://img-fotki.yandex.ru/get/30536/158289418.3a6/0_16d6d4_bf1a6764_XL.png
Анимировать: https://cloud.mail.ru/public/Ft3F/o4v8jS5ov

Совмещение пикотехнологической модели ДНК (электронный слой) с пикотехнологической моделью белка TBP1


Victoriy пишет:

Вопрос к А.Ю.: Ваш файл pdb для нуклеотидной последовательности соответствует общепринятой последовательности атомов в нуклеотиде? Если да, то я буду тоже ориентироваться на данную нумерацию и последовательность атомов, если Вы не сверяли, то это придётся уточнять для однозначного воспроизведения координатных файлов нуклеиновых кислот вьюерами.

Кушелев: Я взял из базы PDB-файл с ДНК и просто поменял координаты.


Формы, механизмы, энергия наномира. Сообщение 83 100

Skype, 2016-12-19:

[16:18:31] Andrei: так подождем до второй модели?
[16:26:39] Кушелев Александр Юрьевич: Вообще-то и первая модель белка - гарантия успеха
[16:27:36] Кушелев Александр Юрьевич: Так что можно посылать 4 ролика анимации, а PDB-модель нужно смасштабировать на коэффициент 0.6 Лучше это сделать самим.
[16:27:53] Кушелев Александр Юрьевич: Жаль, что программист занят. Он бы это сделал за 5 минут
[16:28:05] Andrei: не проблема, подождем
[16:28:57] Кушелев Александр Юрьевич: Через час-два попробую разобраться со вторым белком
[16:29:19] Кушелев Александр Юрьевич: Он не такой очевидный, а в базе данных PDB вообще "полный привет" smile
[16:30:04] Кушелев Александр Юрьевич: Там альфа-спирали нарисовали "как бог на душу положит", а модель ДНК с неправильной ориентацией ступеней, поэтому короче в 4 раза smile
[16:30:21] Andrei: https://cloud.mail.ru/public/5j2J/R81Y4QJjC
[16:30:29] Andrei: это не работает
[16:30:41] Andrei: и вторая тоже
[16:30:48] Кушелев Александр Юрьевич: Я заменил 2 ролика на 4
[16:30:51] Andrei: аа
[16:31:06] Кушелев Александр Юрьевич: Названия поменялись, поэтому я старые два стёр
[16:31:19] Andrei: надо было тут тоже стереть
[16:31:26] Кушелев Александр Юрьевич: ОК
[16:31:33] Кушелев Александр Юрьевич: Исправлюсь в будущем
[16:31:45] Кушелев Александр Юрьевич: Появлюсь через час-два
[16:34:46] Andrei: может там надо подписать в видео что там что?
[17:59:16] Кушелев Александр Юрьевич: Там в названии подписано
[17:59:36] Andrei: ну пусть так
[18:00:05] Кушелев Александр Юрьевич:
[16:28:20] Кушелев Александр Юрьевич: Привет! А ты можешь все координаты в PDB-файле умножить на 0.6 ?
[17:43:34] Va12220(valqwa): МОГУ )
сегодня как доеду и вспомню - то сделаю
[18:00:37] Andrei: отлично
[19:00:33] Кушелев Александр Юрьевич: Комплекс TBP1+DNA идеально вложился в полость белка TFIIB smile
Сейчас компьютер делает анимацию.
[19:00:42] Andrei: супер
[19:01:55] Кушелев Александр Юрьевич: Виктория написала на форуме, что против моей модели ДНК. Интересно будет посмотреть, как вставится в комплекс модель ДНК от Виктории. Она пыталась сделать свою модель ДНК максимально приближенной к общепринятой, т.е. из банка PDB
[19:27:43] Кушелев Александр Юрьевич: Это ещё один ролик с TBP1, но без электронного слоя. Так больше видно. https://cloud.mail.ru/public/BR8K/MoUHKhtG5
[19:28:10] Кушелев Александр Юрьевич:

А это ролик всего комплекса 1VOL:

https://cloud.mail.ru/public/5eaU/5T7v7mCwM

https://img-fotki.yandex.ru/get/49312/158289418.3a6/0_16d828_a1b23880_XL.png
[19:29:15] Кушелев Александр Юрьевич: Короче, ДНК вставляется в маленький белок TBP1, а он в свою очередь вставляется в полость более крупного белка TFIIB
[19:31:07] Кушелев Александр Юрьевич: Конечно, нужно ещё применить инструмент "молекулярная динамика", чтобы из жесткой геометрической модели получить гибкую физическую, но это уже профессионалы разберутся smile
[19:36:57] Кушелев Александр Юрьевич: Кстати, Виктория написала на форуме, что совмещение белков автоматизировано. Так что наш заказчик может самостоятельно совместить PDB-файл модели DNA/RNA с моделью белка TBP1, а потом совместить этот комплекс с белком TFIIB. Технологию молекулярной динамики нужно будет применить сначала после, а потом до совмещения. Если молекулярная динамика на уровне нанотехнологии портит пикотехнологические модели, то применение до совмещения даст хуже результат совмещения.
Кстати, комплекс 1VOL похож на 3 матрёшки. Самая маленькая - ДНК, вторая - белок TBP1, а самая большая - белок TBIIB
[19:37:43] Andrei: так ее модель тоже подошла?
[19:38:59] Кушелев Александр Юрьевич: Виктории? Это мы скоро узнаем smile
[19:39:03] Andrei: молекулярная динамика это известное что-то всем?
[19:39:10] Кушелев Александр Юрьевич: Да
[19:39:21] Кушелев Александр Юрьевич: Программа PyMol её может делать
[19:39:49] Кушелев Александр Юрьевич: У Виктории и у заказчика она есть, а у меня была, но сейчас нет
[19:40:19] Кушелев Александр Юрьевич: Для неё желательно отдельный компьютер иметь, иначе может всё посыпаться...



Andrei01 пишет:Victoriy пишет:

Вопрос к Андрею: Вы порекомендовали заказчице покрутить мои модели в Молекулярной Динамике? Мне кажется, что после такой процедуры сходство с моделями, построенными по данным РСА, должно стать ещё больше.

Виктория, а вы можете примеры привести, что сходство увеличится? То есть разница в 18А там уменьшится?

Victoriy

Андрей, я уже Вам писала, что в отличие от Кушелева, моя программа моделирует не конечную конформацию белка, а его СТРУКТУРНЫЙ ШАБЛОН (хотя он оказался ближе к экспериментальным моделям, чем у А.Ю.). Т.е. это структура белка, которая синтезируется на рибосоме БЕЗ влияния микроокружения, но по собственному генкоду (точнее гену). В клетке после того, как структурный шаблон белка синтезирован он подвергается действию всевозможных физических сил (начиная от электростатических и заканчивая Ван-дер-вальсовыми). Этот процесс носит название фолдинг белка. Так вот, процесс фолдинга моего структурного шаблона в конечную конформацию белка можно смоделировать при помощи молекулярной динамики. Мы получим функциональную конформацию белка, которая будет сравнима с моделями, построенными по данным РСА. И разумеется разница в 16,5 Ангстрем должна в разы уменьшиться. А сейчас заказчик сравнивает жесткий скелет с гибким телом и естественно получает такие расхождения. Вот я и предлагаю заказчику самостоятельно превратить скелет в гибкое тело, удивиться и поверить в свой собственный результат, тем более, что нужен он ей, а не мне.

Victoriy А.Ю., обратите внимание, что Вы сделали модель комплекса с 3-мя нуклеотидами, вместо 16. И если в узле состыковки нуклеотидные хвосты не актуальны, то комплементарные пары нуклеотидов должны быть. Я так думаю:)

Andrei01

Виктория, хорошо. Напишу им об этом. Поэтому они и слали свои данные, чтобы мы поняли почему такое различие большое в 6 раз.

Формы, механизмы, энергия наномира. Сообщение 83 107

Victoriy пишет:

в отличие от Кушелева, моя программа моделирует не конечную конформацию белка, а его СТРУКТУРНЫЙ ШАБЛОН (хотя он оказался ближе к экспериментальным моделям, чем у А.Ю.)

Кушелев

Уважаемая Виктория! А Вы не могли бы осуществить автоматических докинг моделей белков TBP1 и TFIIB ?

Интересно посмотреть, состыкуются ли Ваши модели между собой и мои модели между собой автоматически?

Вручную у меня получилось: https://cloud.mail.ru/public/5eaU/5T7v7mCwM

https://img-fotki.yandex.ru/get/49312/158289418.3a6/0_16d828_a1b23880_XL.png

Теперь интересно проверить автоматизированный докинг. Насколько он работоспособен? smile

Кстати, непонятно, как Ваша программа строит 310-спирали? По Вашей таблице их в шаблоне быть не должно...

Victoriy пишет:

А.Ю., обратите внимание, что Вы сделали модель комплекса с 3-мя нуклеотидами, вместо 16. И если в узле состыковки нуклеотидные хвосты не актуальны, то комплементарные пары нуклеотидов должны быть. Я так думаю:)

Кушелев: Я специально убрал половину нуклеотидов, чтобы виднее было. А на модели, где показаны только ядра, ступени целые (пары нуклеотидов). В файле PDB тоже модель двойной ДНК, причём все 16 ступеней.

А заказчик может укорачивать и разбирать модель ДНК из PDB-файла по своему усмотрению.

Формы, механизмы, энергия наномира. Сообщение 83 109

Andrei01 пишет:

Виктория, хорошо. Напишу им об этом. Поэтому они и слали свои данные, чтобы мы поняли почему такое различие большое в 6 раз.

Кушелев: Самое интересное - провести автоматический докинг для комплекса 1VOL. Он должен дать разный результат для вариантов моделей Виктории Соколик и Александра Кушелева. Интересно же посмотреть, в каком варианте лучше состыкуются белки между собой и с ДНК smile


Victoriy

Увы, у меня пока нет навыков самостоятельного выполнения докинга, тем более 3 высокомолекулярных полимеров. С коллегами из Киева в этом году был сделан докинг куска из 63 а.о. белка предшественника амилоида (AбетаPP), содержащего сам бета-амилоидный пептид, с куркумином. Опубликовано в Advances in Biochemistry. – 2016. – V. 4, Is. 4. – P. 34-46.
Поэтому я и призываю в нашу команду биоинженера/молекулярного биолога с опытом работы в молекулярном моделировании.


Кушелев: А может быть программы типа PyMol могут автоматически выполнять докинг двух белковых молекул?


Victoriy

Мы использовали инструмент CCDC GOLD Suite 5.1 для докинга и его же оценочные функции для характеристики устойчивости комплекса. Для меня PyMol не более чем вьюер.


Татьяна Рясина

На сегодняшний день мы стали проще относиться к идолу РСА в результате продолжительной беседы.

Почему бы не выработать отношение попроще и к идолу ДНК?

Вот допустим ответы по задачке заказчицы готовы, пусть они даже отправлены.

Можно же написать что-то вроде, вдогонку:
Позвольте ознакомить Вас с нашей критикой общепринятой модели ДНК
Мы провели моделирование ДНК методами Пикотехнологии.
Наши поправки по алгоритмам Пикотехнологии выявили следующие различия с общепринятой моделью /....../
Корректность наших поправок подтверждается тем что /...../
В дополнении к только что решённой нами для Вас задаче и при совмещении полученной структуры и нашей модели ДНК мы получим следующее /......./ Таким образом /......./

И ещё вопрос к уважаемым изобретателям Пикотеха:
кто напишет в Германию в лабораторию которая увидела электроны-колечки на АСМ
про то что:
1) мы занимаемся моделированием атомов, молекул и молекулярных структур с помощью модельного представления об электронов как о закольцованных стоячих волнах (ссылки)
2) Ваша работа подтверждает эти модели
3) Мы разработали Пикотех для моделирования белковых структур
3) Проверьте пожалуйста базовые структуры белков экспериментально (список наименований, дизайн эксперимента)

Андрей и Виктория, вы можете сформировать максимально полый список критики,  вопросов, опровержений и пр. по модели ДНК А.Ю., чтобы в итоге получить хорошую аргументацию в её пользу...


Кушелев

Всё это актуально, но сложно на уровне голого энтузиазма. Нужно найти заинтересованных людей, которые продвинут новое научное направление "по полной программе". Ведь пикотехнология белков была создана уже в 1993-ем году, а развивается она без нормального финансирования "черепашьими шагами"...



Victoriy пишет:

А.Ю., мне интересно: в Вашей модели комплекса последовательность нуклеотидов не имеет значение?

Кушелев: Нет, конечно. Если комплекс занимается транскрипцией ДНК, то он должен одинаково хорошо заниматься транскрипцией любых последовательностей.

Кстати, ключевые аминокислотные остатки как бы прикасаются к центральным зонам соседних ступеней ДНК:

https://img-fotki.yandex.ru/get/197102/158289418.3a6/0_16d875_2ffb2fe9_XL.png


Skype:

[19.12.2016 19:44:15] Andrei: Щас попробую все оформить и послать им
[19.12.2016 19:47:32] Кушелев Александр Юрьевич: Скоро приедет домой программист. Тогда будет нормальный PDB-файл DNA / RNA
[19.12.2016 19:56:12] Andrei: а, я думал уже готово
[19.12.2016 19:56:42] Andrei: А это ролик всего комплекса 1VOL:
[19.12.2016 20:00:15] Кушелев Александр Юрьевич: Ролик-то готов, а PDB-файл ДНК/РНК ещё не готов
[19.12.2016 20:01:58] Andrei: Книга вроде 74 евро стоит
[19.12.2016 20:02:20] Кушелев Александр Юрьевич: Да. Электронный вариант 6 USD
[19.12.2016 20:02:31] Andrei: там не было электронного варианта
[19.12.2016 20:02:48] Кушелев Александр Юрьевич: У авторов есть
[19.12.2016 20:04:45] Andrei: как называется ядерный слой на английском?
[19.12.2016 20:05:23] Кушелев Александр Юрьевич: nuclear
[19.12.2016 20:05:56] Andrei: nuclear layer?
[19.12.2016 20:06:15] Кушелев Александр Юрьевич: Да. В файлах подписано nuclear и electronic
[19.12.2016 20:06:34] Andrei: ок
[19.12.2016 20:06:59] Andrei: Файлы лучше загружать на dropbox
[19.12.2016 20:07:36] Andrei: а то сайт на русском, они не поймут
[19.12.2016 20:08:29] Кушелев Александр Юрьевич: Загрузите, если сможете smile
[19.12.2016 20:08:42] Andrei: загружаю
[19.12.2016 20:08:44] Кушелев Александр Юрьевич: Или в письмо вложите
[19.12.2016 20:09:05] Andrei: в письмо не получится, тот сайт на русском
[19.12.2016 20:09:29] Кушелев Александр Юрьевич: Вы тогда ссылочку на эти файлы в dropbox опубликуйте, чтобы англоязычные читатели форума тоже смогли скачать и изучить.
[19.12.2016 20:09:46] Кушелев Александр Юрьевич: Сами файлы в письмо можно вложить по любому
[19.12.2016 20:10:04] Andrei: нет конечно, почта не пропустит
[19.12.2016 20:10:34] Andrei: я не даю ссылки для всех
[19.12.2016 20:11:13] Кушелев Александр Юрьевич: Только русскоязычным разрешаете файлы скачивать? wink
[19.12.2016 20:11:33] Andrei: там настройки есть
[19.12.2016 20:11:40] Кушелев Александр Юрьевич: Ушлые китайцы всё-равно с облака мэйл ру скачают smile
[19.12.2016 20:11:40] Andrei: надо настраивать специально
[19.12.2016 20:45:19] Andrei: так у вас тоже не учитываются силы на белок как у Виктории?
[19.12.2016 20:49:08] Кушелев Александр Юрьевич: Мой алгоритм пока реализован на геометрическом уровне, но генетический код дублирует физико-химические взаимодействия, поэтому подавляющее большинство участков белковых молекул не модифицируются после рибосомальной сборки белка. А те, которые модифицируются, можно смоделировать по дополнительной информации. Бывают и редкие случае, когда "всё сложно"
[19.12.2016 20:50:41] Кушелев Александр Юрьевич: В нашем случае 1VOL похоже, что белки не модифицируются, но в нормальных условиях они могут гнуться, защёлкиваться и т.д. Так что по хорошему учитывать физику и химию нужно.
[19.12.2016 20:50:57] Кушелев Александр Юрьевич: Это уже проблема заказчика.
[19.12.2016 20:51:30] Кушелев Александр Юрьевич: Если нам закажут исследование динамики белка, тогда это будет уже "совсем другая песня" и "совсем другие деньги"
[19.12.2016 20:51:58] Andrei: а почему же тогда оно налезло друг на друга само?
[19.12.2016 20:52:52] Кушелев Александр Юрьевич: Исследователи белков могут выращивать кристаллы в разных условиях, добиваясь фиксации молекул в разных состояниях. В результате они могут получить "фотки" в разных положениях частей молекулы белка.
[19.12.2016 20:53:38] Кушелев Александр Юрьевич: В нашем случае ДНК и белки совместились, т.к. их форма сильно не меняется после сборки рибосомой
[19.12.2016 20:54:09] Кушелев Александр Юрьевич: А бывают белки, которые надкусываются, из кусков собираются крупные агрегаты и т.д.
[19.12.2016 22:50:42] Кушелев Александр Юрьевич: Программист ещё едет домой smile
[19.12.2016 22:50:59] Кушелев Александр Юрьевич: А Вы аннотацию к книге "Пикотехнология белков" заказчику посылали?
[19.12.2016 22:51:01] Кушелев Александр Юрьевич:
The greatest enemy of knowledge is not ignorance, it is the illusion
Stephen Hawking
Sokolik VV, Kushelev AY
Geometry live nanoworld. Pikotechnology proteins / VV Sokolik, AY Kushelev. -
Kharkov: Publishing, 2015. – 255 p.

ISBN 978-3-659-92862-8

The monograph is devoted to the 3D-structure of molecules and polymers in
living systems. The analysis of the modern understanding of the fundamental concepts
of the physical volume of the atom, chemical bonding, and the genetic code is
presented. Based on statistical analysis of the experimental data on the protein structure
is justified coding secondary structure and structural polypeptide template of protein
in the genome. Propose additions table of the genetic code of proteins and peptides,
which formed the basis of the geometric algorithm software decoding structural
template protein, are Molecular Constructor and Picotex. The hypothesis of recoding
information to third nucleotide codon in the corresponding peptide bond rotamer directly
3D-structure isoacceptors tRNA is formulated. Mathematical analysis of contingency
angles φ and ψ (Ramachandran map) revealed their frequency changes as
possible to substantiate the mechanism of post-translational protein folding.
The book is intended for professionals involved in research in the field of molecular
biology, bioinformatics, biochemistry and biophysics.
Table: 36. Ill: 117. Refs: 227 titles.
[19.12.2016 22:51:40] Andrei: Ну как доедет, не горит)
[19.12.2016 22:51:52] Andrei: Посылал
[19.12.2016 22:52:12] Кушелев Александр Юрьевич: А рецензии?
[19.12.2016 22:52:14] Кушелев Александр Юрьевич: http://nanoworld.org.ru/topic/1150/
[19.12.2016 22:52:26] Кушелев Александр Юрьевич: Это самое научное...
[19.12.2016 22:56:29] Andrei: тоже, это все теория
[19.12.2016 22:56:34] Andrei: нужны примеры
[19.12.2016 22:57:52] Кушелев Александр Юрьевич: Какая же теория, когда речь идёт о модельных экспериментах, подтверждённых в 2015-ом году натурными (АСМ)?
[19.12.2016 22:58:15] Andrei: на практике нет применений
[19.12.2016 22:59:20] Кушелев Александр Юрьевич: Пикотехнология белков - это и есть практическая технология, которая базируется на модельных экспериментах теперь уже подтверждённых прямыми экспериментами (АСМ)
[19.12.2016 23:00:00] Andrei: коммерческой прибыли нет от этого на практике
[19.12.2016 23:00:05] Andrei: надо искать
[19.12.2016 23:01:25] Кушелев Александр Юрьевич: Виктория пишет, что не владеет программой, где делается автоматический докинг. Может быть имеет смысл попросить заказчика применить автоматический докинг для сравнения моделей белков и ДНК от Кушелева и Соколик?
А раз заказчик может сравнивать модель Кушелева с моделью из PDB, значит сможет сравнить и модель Кушелева с моделью Соколик. Интересно, на сколько ангстрем отличаются наши модели?
[19.12.2016 23:01:36] Кушелев Александр Юрьевич: Прибыль будет, не торопитесь.
[19.12.2016 23:01:52] Andrei: ничего просить не можем
[19.12.2016 23:02:22] Кушелев Александр Юрьевич: А предлагать?
[19.12.2016 23:02:31] Andrei: покажем идеи а дальше если стоящая то может быть сможет найти практическое применение
[19.12.2016 23:03:24] Кушелев Александр Юрьевич: Они же сами заинтересованы сделать модель комплекса 1VOL. Если они умеют делать автоматический докинг, то смогут попытаться сделать его в варианте моделей Кушелева и Соколик. В одном из вариантов должно получиться лучше.
[19.12.2016 23:03:38] Кушелев Александр Юрьевич: У меня вручную получилось, а у них автоматически должно получиться.
[19.12.2016 23:04:04] Andrei: зачем им это
[19.12.2016 23:06:16] Кушелев Александр Юрьевич: Их цель, как я понял, выяснить механизм работы комплекса 1VOL
[19.12.2016 23:06:30] Кушелев Александр Юрьевич: Применить для этого автоматический докинг - сам бог велел smile
[19.12.2016 23:07:15] Кушелев Александр Юрьевич: А дальше они могут сравнить, какие модели лучше собираются в "матрёшки", от Кушелева или от Виктории. Они же рассчитали 18 и 16.5 ангстрем?
[19.12.2016 23:07:20] Кушелев Александр Юрьевич: Значит нужно.
[19.12.2016 23:07:30] Andrei: что дает докинг?
[19.12.2016 23:08:04] Кушелев Александр Юрьевич: Автоматическую сборку "матрёшки". Я-то делал вручную. Интересно получится та же структура в автоматическом режиме?
[19.12.2016 23:08:36] Andrei: пусть сначала это посмотрят
[19.12.2016 23:08:46] Andrei: посмотрим что скажут
[19.12.2016 23:08:47] Кушелев Александр Юрьевич: Безусловно



Skype, 2016-12-20:

[0:33:35] Кушелев Александр Юрьевич: Программист добрался до дома. Сказал, что сейчас сделает PDB-файл ДНК
[0:52:15] Кушелев Александр Юрьевич: Файл готов: http://nanoworld.org.ru/post/80584/#p80584

https://img-fotki.yandex.ru/get/196161/158289418.3a6/0_16d877_bbba6c36_XL.png

https://img-fotki.yandex.ru/get/195125/158289418.3a6/0_16d878_6d535a5d_XL.png

PDB-файл: https://cloud.mail.ru/public/LNUH/7JNWA75Nk



ОБНАРУЖЕНА ОШИБКА В ПРОГРАММЕ, ИСПРАВЛЯЕМ   1 ,  2


aest пишет:

вы пытались продавать наивным биологам ваши модели белков по 10000 уе, заверяя о пикоточности в то время, как у вас в алгоритме ошибка была ? Некрасиво как-то получается.

Кушелев: Конечно некрасиво. Поэтому пытаемся исправить ошибку, но это дело непростое... Углы уже удалось исправить, но в программе Дениса Савина где-то ещё запрятаны смещения. Ищем smile





Молекулярные биологи осваивают пикотехнологию. Шаг спирали ДНК гораздо длиннее!


http://subscribe.ru/archive/science.news.nanoworldnews/201201/22182353.html?fromissue=1


 

Благодаря поддержке инвесторов (приобретен мощный компьютер), в лаборатории Наномир появилась возможность полноценно моделировать крупные белки, в частности, коллаген. Слева упрощённая модель одной молекулы коллагена, а справа - полновесная (кольцегранная + шар-труба), построенная с помощью скрипта Савина-Кушелева.

Полновесный скрипт Савина-Кушелева сохраняет файлы в стандарте PDB (Protein Data Base), которые фактически являются коммерческим продуктом лаборатории Наномир, т.к. имеют более высокую точность, чем файлы, полученные с помощью РСА (рентгеноструктурного анализа).

Файл с координатами атомов коллагена: http://nanoworld2003.narod.ru/collagen2012011801.ent

Напомню, что цена модели зависит от точности ~квадратично. Точность пикотехнологической модели выше, чем точность РСА в ~1000 раз. Следовательно её цена в ~1 000 000 раз выше. А для тех белков, которые не кристаллизуются, РСА вообще непригоден. Тем не менее РСА не потеряет актуальность, т.к. позволяет исследовать модифицированные структуры белков, что недоступно первой коммерческой версии программы Пикотех, в которой учтена только модель рибосомы.

 

Файл в стандарте PDB позволяет смотреть структуру белка стандартными браузерами, а так же использовать программы, которые учитывают физико-химические взаимодействия на уровне нанотехнологии.

 

Например, Swiss viewer умеет рассчитывать поверхность молекулы (на уровне нанотех, естественно)

А те, кто желает изучить пикотехнологическую модель "по полной программе", могут установить на свой компьютер 3DS Max и открыть файл (150Mb) со структурой спирали коллагена (полтора витка, образованные 16-ю молекулами коллагена: http://narod.ru/disk/38221464001/collagen2012011811.max.html

 

В этом файле кроме 16 моделей молекулы коллагена содержится ещё одна упрощённая модель коллагена. Из неё можно построить спираль раз в 40 длиннее, чем из полновесной (кольцегранной) при том же числе треугольных граней.

Отдельные кадры (3200x2400)

Если у Вас есть желание сделать профессиональную компьютерную графику на основе пикотехнологических моделей, могу дать все необходимые данные ...

 Анимацию спирали коллагена можно просматривать по кадрам (3200х2400 пикселей, 140  кадров) в архиве.

 Кадры записаны в стандарте jpg, что позволяет просматривать анимацию по кадрам в обычном браузере картинок.

 

Эта анимация сделана из 3 кадров, уменьшенных до размера 1450x1088. Модель для 3DS Max.

Обсуждение.

 Нобелевский глюк рибосомы ...

Skype (2012-01-17):

[8:10:10] L: Поправленный перевод: The business offer for a owners of your company. In the near future auction of high technologies of laboratory the Nanoworld can take place. We offer the new standard of structure of peptide (protein) PIKO. This standard now is discussed at forums. At schools of Russia since 2005 study pikotechnological models of atoms, molecules and crystals. Precision pikotechnological models ~1000 times higher than precision of nano-models. Your firm could become the leader of sales pikotech-models... I invite you to auction of high technologies of laboratory the Nanoworld: http://nanoworld.org.ru/topic/205/

[8:49:32] Кушелев Александр Юрьевич: Благодарю! 

 

Зелёным цветом показана информационная РНК, которая якобы проходит сквозь рибосому. В действительности, существует разрыв иРНК длиной ~30 нуклеотидов. Откуда он берётся? тРНК приплывает с очередной аминокислотой, врезается во входящий в рибосому конец иРНК и откусывает от неё триплет. Далее поворачивается по инерции до терминирующего поворот рибосомального нуклеотида. После этого другой (АСС) конец тРНК вставляет аминокислоту в растущую белковую молекулу. Затем тРНК (вместе с триплетом иРНК!) поворачивается вокруг аминокислотного остатка на тупой угол. При этом триплет иРНК уходит на расстояние около 3 витков спирали РНК от первоначального положения. Далее тРНК снова поворачивается, отсоединяясь от растущей белковой молекулы, но после того, как к ней присоединён следующий аминокислотный остаток. Вращается она до тех пор, пока не присоединит триплет иРНК к выходящему концу. Таким образом, создаётся иллюзия, что иРНК проходит сквозь рибосому без изменений. На самом деле на входе в рибосому иРНК дробится на триплеты, а на выходе из рибосомы снова собирается в спираль РНК.

Этот процесс оказался незамеченным для исследователей структуры рибосомы, которые получили за эту структуру нобелевскую премию в 2009-ом году. При этом заявленная точность структуры рибосомы ~2 ангстрема, а реальная ошибка превосходит в полтора раза габариты тРНК, т.е. достигает ~3 витков РНК (~30 нуклеотидов). Таким образом, реальная ошибка модели рибосомы порядка 240 ангстрем (24 нанометров, 24 000 пикометров).

 

Рибосомы эукариот: 80S, размер - 22x32 нм. Они крупнее прокариотических.

Шаг спирали ДНК/РНК гораздо длиннее!

По вертикальным ступеням ходить горизонтально? 

 

 Пикотехнологическая модель показывает, что длина витка спирали не 3.4, а 8 нм!

Подробнее

Величина 3.4 нм гипотетическая... Пикотехнологический модельный эксперимент опровергает эту гипотезу 

  

Модельный эксперимент показывает, что при образовании ступени ДНК параллельно с водородными связями образуются поперечные фосфодиэфирные связи:

Подробнее. 

Программа Пикотех помогает биологам делать научные открытия!

Научные работы Виктории Соколик

http://subscribe.ru/archive/science.news.nanoworldnews/201004/19221806.html

Уважаемые читатели! Предлагаю Вашему вниманию научную статью Виктории Соколик, содержащую очень важное научное открытие, которое помогла сделать программа "Пикотех". Речь идёт о механизме возникновения обширной группы наследственных болезней, с которыми можно справиться благодаря пикотехнологии. В связи с важностью научного открытия привожу статью полностью.

Украiнський вiсник психоневрологii – 2009. – Т.46, вип.8.- С. 116—121.





















Научные работы Виктории Соколик

Обсуждение на форуме лаборатории Наномир.


Виктория Соколик в лаборатории Наномир

http://img-fotki.yandex.ru/get/4212/nanoworld.1a6/0_3c3f7_b86aa3c5_L.jpg

16 апреля 2010 года Виктория Соколик приехала в г. Дмитров

http://img-fotki.yandex.ru/get/4208/nanoworld.1a6/0_3c3f9_b9176585_L.jpg

Ещё на железнодорожном вокзале началась научная дискуссия на тему "Пикотехнологические модели ДНК"...

http://img-fotki.yandex.ru/get/4213/nanoworld.1a6/0_3c3fa_25ce204a_L.jpg

Богиня биологии перевернула пакет, и из него, как из Рога изобилия посыпались пикотехнологические модели белковых молекул и молекул РНК/ДНК...

http://img-fotki.yandex.ru/get/11/nanoworld.1a6/0_3c3fb_e4c73073_L.jpg

Ярослав Старухин: "Разрешите заснять Ваши пикотехнологические модели на видео!"

http://img-fotki.yandex.ru/get/4210/nanoworld.1a6/0_3c3fc_5d5ac345_L.jpg

Александр Кушелев: "Пока Ярослав записывает Ваши замечательные модели на видео, позвольте полюбопытствовать, как Вам удалось сделать модели такими яркими, цветными?"

http://img-fotki.yandex.ru/get/7/nanoworld.1a6/0_3c3fd_960afece_L.jpg

Виктория Соколик: "Вообще-то это - Ноу-Хау, но Вам я по секрету скажу. Я покрасила кольца лаком для ногтей разных цветов"

http://img-fotki.yandex.ru/get/2914/nanoworld.1a6/0_3c3fe_28028c70_L.jpg

Кушелев: Я бы до этого гениального решения ни за что бы не додумался!

http://img-fotki.yandex.ru/get/4308/nanoworld.1a6/0_3c3ff_1684770c_orig.jpg

В качестве лирического отступления предлагаю посмотреть 45-секундную ТВ-передачу из лаборатории Наномир, где речь идёт о пикотехнологической модели молекулы тимогена.

Это - материал из видеоархива лаборатории Наномир. Первая часть видеоархива. Там Вы сможете посмотреть самые первые видеозаписи из лаборатории Наномир, сделанные в 1992-1993 годах.

http://img-fotki.yandex.ru/get/4312/nanoworld.1a6/0_3c401_1726603d_L.jpg

Кушелев: Ого! Они у Вас ещё и поворачиваются на шарнирах?!

http://img-fotki.yandex.ru/get/4311/nanoworld.1a6/0_3c402_6508b624_L.jpg

Виктория: А Вы как думали? Эта модель показывает переход ротамеров, кодируемых композиционным генетическим кодом. В первом приближении наши модели совпадают, но есть, как видите, и отличия. Например, радикал аминокислот в моей модели соединён с другой гранью атома углерода.

http://img-fotki.yandex.ru/get/4311/nanoworld.1a6/0_3c403_1f5cf538_L.jpg

Виктория: Эта модель помогла мне сделать научное открытие, о котором я рассказываю в научной статье. Эту статью Вы можете опубликовать на форуме вместе со ссылкой на публикацию в академическом журнале.

http://img-fotki.yandex.ru/get/4214/nanoworld.1a7/0_3c404_2e30e2a2_L.jpg

Кушелев: Я правильно понял, что серебристым цветом в этой модели показаны CH3-группы, т.е. радикалы аланина?

http://img-fotki.yandex.ru/get/4209/nanoworld.1a7/0_3c405_549c16ce_L.jpg

Виктория: Совершенно верно! А эта модель показывает переход ротамеров. Следующий остаток в этой модели может поворачиваться вокруг оси и фиксироваться в положениях 0, +120 и -120 градусов.

http://img-fotki.yandex.ru/get/4308/nanoworld.1a7/0_3c406_19d12edc_L.jpg

Вот я поворачиваю следующий остаток относительно предыдущего и получается другой ротамер, который, естественно, кодируется другим триплетом ДНК.

http://img-fotki.yandex.ru/get/4211/nanoworld.1a7/0_3c407_ce4987d6_L.jpg

Кушелев: Вижу. Это третий вариант композиции, т.е. третий ротамер по Вашей терминологии.


Виктория: А это - пикотехнологическая модель амфипатического участка спирали белка. Каждый четвёртый радикал несёт электрический заряд, с помощью которого происходит слипание амфипатических участков спиралей...

http://img-fotki.yandex.ru/get/4209/nanoworld.1a7/0_3c409_d7814f31_L.jpg

Кушелев: Амфи... что?

Виктория: Амфипатического участка.

Кушелев: Надо запомнить ... smile

http://img-fotki.yandex.ru/get/4211/nanoworld.1a7/0_3c40b_4297fd0a_L.jpg

А модель впечатляет. Надо будет почитать Вашу научную статью...

http://img-fotki.yandex.ru/get/4311/nanoworld.1a7/0_3c40c_f6e4a585_L.jpg

Ярослав: А что за научное открытие позволила сделать эта пикотехнологическая модель?

http://img-fotki.yandex.ru/get/9/nanoworld.1a7/0_3c40d_419a2318_L.jpg

Виктория: Мне удалось найти правильное расположение амфипатических участков, которые раньше были определены неправильно.

http://img-fotki.yandex.ru/get/4308/nanoworld.1a7/0_3c40e_7dd4a978_L.jpg

Сейчас я покажу Вам статью и схему этого белка на компьютере...

http://img-fotki.yandex.ru/get/2914/nanoworld.1a7/0_3c40f_84a27043_L.jpg

Кушелев: Отлично. А я пока запишу на видео, как работает Ваша модель ротамеров...

http://img-fotki.yandex.ru/get/55/nanoworld.1a7/0_3c410_93e8f48e_L.jpg

Виктория: А в правой руке у Вас - модель иминокислоты пролина.

http://img-fotki.yandex.ru/get/8/nanoworld.1a7/0_3c411_99620a09_L.jpg

Кушелев: Да, модели шикарные. А NH2-группа в пролине у Вас расположена иначе, чем в аминокислотах?

http://img-fotki.yandex.ru/get/8/nanoworld.1a7/0_3c412_3a49edcb_L.jpg

Виктория: Да.

http://img-fotki.yandex.ru/get/4209/nanoworld.1a7/0_3c413_56198245_L.jpg

Кушелев: У меня тоже сначала была модель, где группа NH2 пролина была расположена иначе, чем в аминокислотах, но позднее я пришёл к выводу, что она находится там же, только вместо жёсткой связи соединена с группой COOH гибкой связью, что позволяет в этом месте организовать сустав между участками альфа-спиралей или других вторичных структур.

http://img-fotki.yandex.ru/get/4311/nanoworld.1a7/0_3c414_64566faf_L.jpg

Поэтому пролин ставится в растущую белковую цепь так же, как и аминокислоты.

http://img-fotki.yandex.ru/get/4310/nanoworld.1a7/0_3c422_c1004398_L.jpg

Кушелев: Все отличия между нашими пикотехнологическими моделями можно обсудить позже на форуме. Там же мы можем разобраться, какая из моделей ближе к истине. Мне без разницы, моя или Ваша. Главное - выяснить, какая конкретно.

http://img-fotki.yandex.ru/get/4309/nanoworld.1a7/0_3c4af_5573ff62_L.jpg

Кушелев: В чём отличие между нашими моделями мне понятно. Дальше эти отличия можно обсуждать на форуме, а теперь хотелось бы посмотреть Ваши научные статьи на компьютере...

http://img-fotki.yandex.ru/get/4307/nanoworld.1a7/0_3c4b0_406a10e5_L.jpg

Самые интересные фрагменты научной дискуссии удалось записать на видео благодаря Анатолию Шестопалову. Благодарим Вас, Анатолий!

http://img-fotki.yandex.ru/get/2914/nanoworld.1a7/0_3c4b1_9cf8e5a2_L.jpg

Люба тоже принимала активное участие в дискуссии и в конце-концов разобрала модель ротамеров, но смогла потом снова собрать. smile

http://img-fotki.yandex.ru/get/4208/nanoworld.1a7/0_3c4b2_d2bcafc4_L.jpg

Кушелев: Модель АСС-конца транспортной РНК помогает понять, под каким углом расположены следующий и предыдущий аминокислотные остатки в момент выдавливания группы OH предыдущего остатка группой NH3 следующего остатка.

http://img-fotki.yandex.ru/get/4310/nanoworld.1a7/0_3c4b3_56334ac6_L.jpg

Виктория: А давайте сделаем модель транспортной РНК целиком.

Кушелев: Так там 90 ступеней ДНК...

Виктория: Ну и что? Не так уж много. Можно на компьютере попробовать.

Кушелев: Лучше изготовить модель из колец. На компьютере будет проще потом сделать.

http://img-fotki.yandex.ru/get/4212/nanoworld.1a7/0_3c4b5_c293fec2_L.jpg

Вероятно, установка следующего аминокислотного остатка осуществляется под таким углом. Иначе OH-группа не сможет выйти в раствор...

http://img-fotki.yandex.ru/get/2914/nanoworld.1a7/0_3c4c6_d76277d5_L.jpg

Виктория: Вращение ротамеров у нас происходит вокруг этой оси.

http://img-fotki.yandex.ru/get/55/nanoworld.1a7/0_3c4d0_3b7aaaa_L.jpg

Кушелев: А вращение аминокислоты с t-RNA может происходить вокруг другой оси, которая наклонена, например, под тетраэдрическим углом. Кстати, это позволяет уменьшить число ошибок в работе рибосомы...

http://img-fotki.yandex.ru/get/4311/nanoworld.1a7/0_3c4d5_13b8329d_L.jpg

Именно модельный эксперимент позволяет понять, как же работает рибосома...

http://img-fotki.yandex.ru/get/4307/nanoworld.1a7/0_3c4d6_c472a1e5_L.jpg

Справа мы видим фрагмент транспортной РНК (АСС-конец с закреплённой на нём аминокислотой). Группа NH2 должна выдавливать группу OH из предыдущего аминокислотного остатка.

Слева мы видим ротамерную модель Виктории Соколик, которая помогает понять, под каким углом должна двигаться группа NH2, чтобы группа OH смогла выйти в раствор, не разрушив предыдущий аминокислотный остаток.

Различий между пикотехнологическими моделями Виктории Соколик и моими мало. Они заключаются в расположении радикала. Виктория расположила радикал так же, как и Дмитрий Кожевников.

http://img-fotki.yandex.ru/get/4214/nanoworld.1a7/0_3c4d7_fb51f6fe_L.jpg

Виктория Соколик: Значит, в Вашей модели аминокислота удерживается АСС-концом т-РНК с помощью 4 нехимических связей?

Кушелев: Да, четырьмя вандерваальсовыми связями.

http://img-fotki.yandex.ru/get/4312/nanoworld.1a7/0_3c4d8_9a97680b_L.jpg

И этого достаточно, чтобы удержать аминокислоту?

http://img-fotki.yandex.ru/get/4314/nanoworld.1a7/0_3c4d9_2d6239d8_L.jpg

Кушелев: А почему бы и нет?

http://img-fotki.yandex.ru/get/4310/nanoworld.1a7/0_3c4da_900105fd_L.jpg

Виктория Соколик: Видите, какой получился симметричный граф композиций аминокислот?

http://img-fotki.yandex.ru/get/4307/nanoworld.1a7/0_3c4db_a228a60_L.jpg

Кушелев: Это, конечно, здОрово, но нужно разобраться, симметричен он только в теории или в реальности? Может быть в реальности граф композиций не так уж и симметричен? smile

http://img-fotki.yandex.ru/get/9/nanoworld.1a7/0_3c4dc_49de7148_L.jpg

Виктория: Такая симметрия соответствует другой таблице композиционного генетического кода.

Кушелев: А на сколько она отличается от моей?

Виктория: 4 варианта композиции из 64 другие.

Кушелев: -Это мелочи.

Виктория: В науке мелочей не бывает.

Кушелев: Да я шучу. Кстати, даже если все варианты были бы неправильными, то по сравнению с самим фактом существования композиционного генетического кода - это мелочь. Но таблицу, конечно же нужно проверить. Может быть там содержатся ошибки, причём даже такие, о которых мы ещё не знаем...

http://img-fotki.yandex.ru/get/55/nanoworld.1a7/0_3c4dd_2c0e47aa_L.jpg

Виктория: А вот и амфипатические участки, которые удалось открыть с помощью программы "Пикотех". Они оказались совсем не там, где считалось ранее.

http://img-fotki.yandex.ru/get/4209/nanoworld.1a7/0_3c4de_691a1808_L.jpg

Кушелев: Я уже давно заметил, что рентгеноструктурный анализ не позволяет выявлять некоторые структурные особенности белков. Программа "Пикотех" позволяет многое уточнить в базах данных по структурам белка.

http://img-fotki.yandex.ru/get/11/nanoworld.1a7/0_3c4df_a3ba76a5_L.jpg

А тематика конференции в Сыктывкаре очень даже связана с эликсиром "вечной молодости"... smile

http://img-fotki.yandex.ru/get/55/nanoworld.1a7/0_3c4e0_68c0d897_L.jpg

Виктория убеждена, что старость не запрограммирована. Тем не менее она уже помогла мне уточнитьметодику создания эликсира "вечной молодости".

http://img-fotki.yandex.ru/get/8/nanoworld.1a7/0_3c4e2_32e8841_L.jpg

Виктория оставила электронные копии своих научных работ, в т.ч. связанных с пикотехнологией.

http://img-fotki.yandex.ru/get/4210/nanoworld.1a7/0_3c4e3_71b279f_L.jpg

Сегодня я постараюсь опубликовать эти работы на форуме лаборатории Наномир.

http://img-fotki.yandex.ru/get/55/nanoworld.1a7/0_3c4e5_7b23849c_L.jpg

Люба: Уважаемые участники конференции, не пора ли перекусить?

http://img-fotki.yandex.ru/get/55/nanoworld.1a7/0_3c4e7_21d11d80_L.jpg

Можно начать здесь, а продолжить на кухне...

http://img-fotki.yandex.ru/get/4310/nanoworld.1a7/0_3c4e6_f6b38730_L.jpg

Кушелев: В чём отличие между нашими таблицами композиционного генетического кода мне понятно. Обсудить это можно на форуме, а сейчас предлагаю сделать антракт и переместиться на кухню smile

Научные работы Виктории Соколик

Обсуждение

Доклад Виктории Соколик на III Международной конференции «Актуальные проблемы биологии, нанотехнологий и медицины».

Тезисы докладов (1-4 октября 2009 г.), Ростов-на-Дону. – С. 54.






















Научные работы Виктории Соколик

Материал с форума лаборатории Наномир.

http://img-fotki.yandex.ru/get/4310/nanoworld.1a9/0_3c59c_5ae98cca_L.jpg

Кушелев: Обратите внимание на структуру с чередованием кодов альфа-спирали и 3/10-спирали. Могла бы быть такая последовательность кодов, если в таблице не было бы разницы между кодом альфа-спирали и 3/10-спирали?

Виктория: А почему нет?

Кушелев: Трудно поверить, что "гребёнка" 141414141414, где 1 - код альфа-спирали, а 4 - код 3/10-спирали, возникла случайно.

Давайте найдём такие структуры, которые покажут, какая из таблиц правильная.

Начать можно с того, что моя таблица была построена по конкретным экспериментальным данным.

Давайте посмотрим, какие структуры моделей для этих белков получатся при замене моей таблицы на Вашу?

Если структуры изменятся несущественно, значит между нашими таблицами нет принципиальной разницы. Если же изменения будут принципиальными, значит разница есть и с помощью экспериментальных данных можно будет сделать выбор между таблицами.

http://img-fotki.yandex.ru/get/4213/nanoworld.1a9/0_3c59d_51de344b_L.jpg

Обсуждение.


Пикотехнологические модели Виктории Соколик.

Подробнее.


На дмитровском валу...

http://img-fotki.yandex.ru/get/4314/nanoworld.1aa/0_3c5de_73277572_L.jpg

Татьяна Кушелева и Виктория Соколик заинтересовались мегалитическим объектом дмитровский вал.

http://img-fotki.yandex.ru/get/7/nanoworld.1aa/0_3c5df_158e5396_L.jpg

Татьяна Кушелева и Александр Кушелев на мегалитическом объекте, дмитровском валу.

16 апреля 2010 года.

Фото Виктории Соколик.

http://img-fotki.yandex.ru/get/6/nanoworld.1aa/0_3c5e0_bf6980e_L.jpg

Историческая встреча в г.Дмитрове.
Александр Кушелев, Виктория Соколик.

16 апреля 2010 года.

Фото Татьяны Кушелевой.

http://img-fotki.yandex.ru/get/55/nanoworld.1aa/0_3c5e4_409af493_L.jpg

Знакомьтесь, богиня биологии, Виктория Соколик. Дмитровский вал, 16 апреля, 2010г.

http://img-fotki.yandex.ru/get/4210/nanoworld.1aa/0_3c5e5_35518b67_L.jpg

Виктория Соколик и Татьяна Кушелева спускаются с дмитровского вала.

http://img-fotki.yandex.ru/get/4313/nanoworld.1aa/0_3c5e6_91127c7a_L.jpg

http://img-fotki.yandex.ru/get/4311/nanoworld.1aa/0_3c5e7_612bf16e_L.jpg

Виктория сказала, что г.Дмитров ей понравился.


Научные работы Виктории Соколик