Перевести страницу

Классическая волновая физика радиоэфира Фарадея-Максвелла

Рубиновая энергетика и эфироопорные двигатели

Пикотехнология белков

Биотехнология вечной молодости

Исследования мегалитов

Инопланетная инженерия




Найден материал для включения источника энергии ударом!

660 выпуск рассылки


Найден материал для включения источника энергии ударом!


https://encrypted-tbn0.gstatic.com/images?q=tbn:ANd9GcRjtf-DgWf_n8hGF3UmM9lsSX9iOrGiCUzgqsO37_YlB5_u0G47lg

Структура танталата калия 

Цитата:  Танталат калия обладает уникальным свойством - его диэлектрические потери уменьшаются при понижении температуры, достигая значения 3,610-5 при 4,2 К на частоте 13,6 ГГц [23]. 

Конец цитаты.

Материал с форума лаборатории Наномир: 

Кушелев: Это уже совсем интересно...

Дело в том, что танталат калия - сегнетоэлектрик, т.е. по существу он может подойти для включения источника энергии ударом, хотя и при температуре жидкого гелия.

Если мы включим ударом источник энергии из танталата калия, то от него можно будет включить рубиновый источник, настроенный на ту же частоту. Это может оказаться проще, чем включать источник энергии от импульсного магнетрона...

По крайней мере после включения источника энергии при температуре 4.2 К энтузиазм инвесторов просто зашкалит, и они точно найдут денег для ускорения включения рубинового источника энергии "от чего угодно" smile

[0:06:45] mihel-mouse: Так это же при температурах близких к абсолютному нулю((((( При н.у. не заработает же или Вы охлаждать жидким гелием собираетесь?

[0:08:27] Кушелев Александр Юрьевич: А что такого? Может и жидкого азота хватит smile
[0:08:40] Кушелев Александр Юрьевич: А жидким азотом я в летней лаборатории сапфир охлаждал...
[0:09:40] mihel-mouse: Может и хватит, а может и нет, данные бы по зависимости диэлектрических потерь от температуры знать))
[0:09:47] Кушелев Александр Юрьевич: Добротность резонатора, имеющего форму эллипсоида, может быть существенно меньше 50 000. Может быть и 10 000 хватит smile
[0:10:06] Кушелев Александр Юрьевич: Данные найдём...
[0:10:41] Кушелев Александр Юрьевич: Если охлаждённый включится, то инвесторы продадут всё ненужное, чтобы только скорее рубиновый включить.

Цитата:
Рабочая частота   9,6 ГГц 
Магнитное поле   0 – 3500 Гс 
Частота модуляции   100 кГц 
Резонатор сегнетоэлектрический:  
Тип колебания  ТЕ01δ 
Добротность  1000 - 5000

Конец цитаты

Кушелев: При комнатной температуре добротность доходит до 5000. Понятно, что в жидком азоте она перевалит за 10 000, что вполне может хватить для включения источника энергии, имеющего форму эллипсоида. 

[0:15:23] Кушелев Александр Юрьевич: Диэлектрические потери (295 К)  10^3-10^4 Постоянная Кюри-Вейсса   (6±2)10^4 К
[0:29:43] mihel-mouse: А.Ю., теперь, как я понимаю, Вам осталось найти ту лабораторию которая правильно изготовит Вам брусочек из прессованного KTaO3, да ещё и умудрится его поляризовать или Вы нашли уже где купить его уже в виде пьезокерамики?

Кушелев: Сравнительные характеристики сапфир / танталат калия

Материал, Диаметры:

экран внешний-внутренний, мм-мм-мм 
Высота, мм, Частота, MГц, Вес, кг, Источник

Al2O3 112-71.2-45.5 240 1580        [45, 46] 

KTaO3 71.2-70.4       240 1334 1.49 [47] 

Электронное строение тантала:

 

211321882

 

Согласно химической формуле танталата калия KТаO3, тантал проявляет в этом соединении валентность 6-1=5

Если же посмотреть на структурную схему кристаллической ячейки, то

https://encrypted-tbn0.gstatic.com/images?q=tbn:ANd9GcRjtf-DgWf_n8hGF3UmM9lsSX9iOrGiCUzgqsO37_YlB5_u0G47lg

находящийся в центре тантал отдает 6 электронов окружающим атомам кислорода, и получает 1 электрон от находящегося в вершине куба атома кальция. Валентность та же, +5.

На внешней оболочке тантала находится 2 электрона, а ещё 3 он отдает с предвнешней, на которой остается 11-3=8.

Понятно, что эти 8 электронов ориентированы нормалями по направлению из ядра тантала к вершинам кубической ячейки.

Зазоры в октаэдрических вершинах заполняют электроны окружающих атомов кислорода. В результате получается устойчивый электронный каркас танталата калия.

Нужно будет сделать пикотехнологическую модель танталата калия в программе 3DS Max. 


 










Зеленым цветом показаны валентные электроны предвнешней оболочки тантала.


Они образуют общую электронную структуру с достроенной внешней оболочкой атомов кислорода (показаны голубым цветом), расположенных в центрах граней куба. Ближний ион кислорода из 6 не показан, чтобы было лучше видно валентные электроны тантала.

 

Вид через центр отсутствующего иона кислорода. Красным цветом показаны ионы калия, расположенные в вершинах куба.

 

Вид на элементарную ячейку кристалла KTaO3 со стороны отсутствующего иона кислорода

 

Вид на элементарную ячейку кристалла KTaO3 с противоположной стороны

  

Вид вдоль диагонали куба (крупный план)

 

Вид вдоль диагонали куба (общий план) 




Похоже, что ядро тантала со всеми оболочками, кроме предвнешней (она же валентная), может находиться в одном из локальных минимумов энергии, которых, судя по расположению валентных электронов тантала может быть, например, 6. Это и лежит в основе поляризуемости кристалла KTaO3, т.е. в основе сегнетоэлектрических свойств. 


Скрипт, по которому построена пикотехнологическая модель танталата калия в программе 3DS Max:

-- KTaO3. Picotech model
--Nanoworld Laboratory. Alexander Kushelev.
--http://nanoworld.narod.ru
--http://nanoworld.org.ru
--
-- K (red) 8 ions
m = torus radius1:11 radius2:1.1 segs:20 sides:12 position:[0,0,0] wirecolor:[255,0,0]
select m; converttomesh selection
rotate m 90 [0,1,0]; move m [16.5, 0, 0]; m.pivot = [0,0,0]; rotate m -35.27 [0,1,0]; rotate m 45 [0,0,1]
m1 = instance m wirecolor:[255,0,0]; rotate m1 90 [0,0,1]
m2 = instance m1 wirecolor:[0,0,255]; rotate m2 90 [0,0,1]
m3 = instance m2 wirecolor:[255,0,0]; rotate m3 90 [0,0,1]
m4 = instance m3 wirecolor:[0,0,255]; rotate m4 90 [1,0,0]
m5 = instance m4 wirecolor:[255,0,0]; rotate m5 90 [0,0,1]
m6 = instance m5 wirecolor:[0,0,255]; rotate m6 90 [0,0,1]
m7 = instance m6 wirecolor:[255,0,0]; rotate m7 90 [0,0,1]
attach m m1; attach m2 m3; attach m4 m5; attach m6 m7
attach m m2; attach m4 m6; attach m m4
dia = 30; move m [dia, dia, dia]
c1 = instance m wirecolor:[255,0,0]; c1.pivot = [0,0,0]; rotate c1 90 [0,0,1]
c2 = instance c1 wirecolor:[255,0,0]; c2.pivot = [0,0,0]; rotate c2 90 [0,0,1]
c3 = instance c2 wirecolor:[255,0,0]; c3.pivot = [0,0,0]; rotate c3 90 [0,0,1]
c4 = instance c3 wirecolor:[255,0,0]; c4.pivot = [0,0,0]; rotate c4 90 [0,1,0]
c5 = instance c4 wirecolor:[255,0,0]; c5.pivot = [0,0,0]; rotate c5 90 [0,0,1]
c6 = instance c5 wirecolor:[255,0,0]; c6.pivot = [0,0,0]; rotate c6 90 [0,0,1]
c7 = instance c6 wirecolor:[255,0,0]; c7.pivot = [0,0,0]; rotate c7 90 [0,0,1]
--
-- O (blue) 6 ions
mm = torus radius1:11 radius2:1 segs:20 sides:12 position:[0,0,0] wirecolor:[0,0,255]
select mm; converttomesh selection
rotate mm 90 [0,1,0]; move mm [17, 0, 0]; mm.pivot = [0,0,0]; rotate mm -35.27 [0,1,0]; rotate mm 45 [0,0,1]
mm1 = instance mm wirecolor:[0,0,255]; rotate mm1 90 [0,0,1]
mm2 = instance mm1 wirecolor:[0,0,255]; rotate mm2 90 [0,0,1]
mm3 = instance mm2 wirecolor:[0,0,255]; rotate mm3 90 [0,0,1]
mm4 = instance mm3 wirecolor:[0,0,255]; rotate mm4 90 [1,0,0]
mm5 = instance mm4 wirecolor:[0,0,255]; rotate mm5 90 [0,0,1]
mm6 = instance mm5 wirecolor:[0,0,255]; rotate mm6 90 [0,0,1]
mm7 = instance mm6 wirecolor:[0,0,255]; rotate mm7 90 [0,0,1]
attach mm mm1; attach mm2 mm3; attach mm4 mm5; attach mm6 mm7
attach mm mm2; attach mm4 mm6; attach mm mm4
dia2 = 30; move mm [dia, 0, 0]
cc1 = instance mm wirecolor:[0,0,255]; cc1.pivot = [0,0,0]; rotate cc1 90 [0,0,1]
cc2 = instance cc1 wirecolor:[0,0,255]; cc2.pivot = [0,0,0]; rotate cc2 90 [0,0,1]
cc3 = instance cc2 wirecolor:[0,0,255]; cc3.pivot = [0,0,0]; rotate cc3 90 [0,0,1]
cc4 = instance cc3 wirecolor:[0,0,255]; cc4.pivot = [0,0,0]; rotate cc4 90 [1,0,0]
--
-- Ta (green)
t = torus radius1:4 radius2:0.5 segs:20 sides:12 position:[0,0,0] wirecolor:[0,255,0]
select t; converttomesh selection
rotate t 90 [0,1,0]; move t [12, 0, 0]; t.pivot = [0,0,0]; rotate t -35.27 [0,1,0]; rotate t 45 [0,0,1]
t1 = instance t wirecolor:[0,255,0]; rotate t1 90 [0,0,1]
t2 = instance t1 wirecolor:[0,255,0]; rotate t2 90 [0,0,1]
t3 = instance t2 wirecolor:[0,255,0]; rotate t3 90 [0,0,1]
t4 = instance t3 wirecolor:[0,255,0]; rotate t4 90 [1,0,0]
t5 = instance t4 wirecolor:[0,255,0]; rotate t5 90 [0,0,1]
t6 = instance t5 wirecolor:[0,255,0]; rotate t6 90 [0,0,1]
t7 = instance t6 wirecolor:[0,255,0]; rotate t7 90 [0,0,1] 

[20:43:59] Потенциальный инвестор: То есть 5000 долл хватит на запуск?
[21:16:25] Кушелев Александр Юрьевич: Будем надеяться. Гарантию заранее не даст даже Бог smile
[21:26:58] Кушелев Александр Юрьевич: 5000 долл. позволит реализовать два проекта. И пьезо-керамический, и с магнетроном. Но с магнетроном хоть и надежнее, но по-хорошему нужно заказывать номинальный ряд рубиновых резонаторов. У меня в настоящее время есть только несколько небольших участков номинального ряда. Причём некоторые участки перекрыты шариками, а некоторые - эллипсоидами:

https://img-fotki.yandex.ru/get/9822/158289418.200/0_123aee_b1f62d17_XL.jpg

[12:36:03] Главный инвестор alg: поле электромагнитное ?
[12:36:40] Кушелев Александр Юрьевич: Да. Поле электромагнитное. Для частоты 2.45 ГГц диаметр эллипсоида типа 35 мм
[12:37:04] Кушелев Александр Юрьевич: В рассылке были опубликованы данные для эллипсоида.
[12:37:29] Кушелев Александр Юрьевич: Просто я пока не смог экспериментально обнаружить рабочую моду, которая смоделирована в HFSS
[12:37:56] Кушелев Александр Юрьевич: Инвестор D смоделирует процесс возбуждения, и тогда я смогу экспериментально найти эту моду.
[12:39:54] Главный инвестор alg: и последний вопрос как в диэлектрическом не магнитном  шарике образуется электрическое и магнитное поле
[12:41:13] Кушелев Александр Юрьевич: В проводниках возможен ток проводимости, а в диэлектриках - ток смещения. Когда связанные заряды колеблются относительно положения равновесия.
[12:41:50] Кушелев Александр Юрьевич: Поэтому существуют не только проводящие, но и диэлектрические резонаторы и волноводы. Гугл знает smile
[12:42:04] Главный инвестор alg: это и есть та радиоволна которая закачивается в шарик , а шарик как лазер её усиливает и не отпускает и только часть энергии вылазит из шарика на 0,5 см ?
[12:43:05] Кушелев Александр Юрьевич: Волны - это процесс распространения колебаний в среде. В данном диэлектрическом резонаторе таких волн нет. Есть стоячие волны, когда колебания сосредоточены в небольшой области.
[12:43:14] Кушелев Александр Юрьевич: А процесс преобразования энергии такой же, как в дребезжащем редукторе.
[12:43:49] Кушелев Александр Юрьевич: Часть энергии вращения "шестеренок Максвелла" преобразуется в энергию колебаний тех же "шестеренок Максвелла", т.е. в электромагнитные колебания.
[12:44:11] Кушелев Александр Юрьевич: А процесс возбуждения можно посмотреть на модели в программе HFSS:
[12:44:26] Главный инвестор alg: спасибо
[12:46:11] Кушелев Александр Юрьевич:

 

https://img-fotki.yandex.ru/get/46165/158289418.286/0_1477be_833a0bd0_XL.gif[12:46:36] Кушелев Александр Юрьевич: Справа видны более длинные волны в воздухе (проводящий волновод)
[12:46:50] Кушелев Александр Юрьевич: В середине волны короче (диэлектрический волновод)
[12:47:09] Кушелев Александр Юрьевич: А слева резонансная система из рубиновых шариков
[12:47:41] Кушелев Александр Юрьевич: Другой ракурс:

 

 

https://img-fotki.yandex.ru/get/65449/158289418.285/0_146cb0_c246ec23_XL.gif[12:48:38] Кушелев Александр Юрьевич: Крупно один шарик:

 

https://img-fotki.yandex.ru/get/105980/158289418.356/0_16114d_b5936913_XL.gif

[12:50:48] Кушелев Александр Юрьевич: Подробнее: http://nanoworld.org.ru/topic/727/ 

 Подробнее 

 Обсуждение

Нужно ехать на оборонный завод включать рубиновый источник энергии от магнетрона, от которого уже дважды засветили один рубиновый шарик.



    https://img-fotki.yandex.ru/get/894110/249950893.1/0_16b0ae_17f1ba0f_orig.jpg

    https://img-fotki.yandex.ru/get/878955/249950893.0/0_165798_303d9f78_orig.png



    http://nanoworld.org.ru/post/96421/#p96421
    1. Предполагаемые габаритные размеры: 0.3*0.3*0.03 м на 1 тонну силы.
    2. Способы крепления установки к корпусу: Стандартные, т.е. такие же, как у реактивного двигателя.
    3. Тип топлива: Топливо отсутствует. Ruby Emdrive - бестопливный двигатель.
    4. Энергоэфективность - столько тонн может поднимать. При массе двигателя 1 кГ подъёмная сила около тонны. Зависимость линейная, т.е. на каждую тонну силы нужно 1 кГ массы двигателя.
    5. В каких средах работает: В космосе, в атмосфере, под водой и под землёй.
    6. Ресурс двигателя: Не ограничен.
    7. Предельные режимы работы: Ускорение не более 10 000 "жэ". Температура не более 2000 градусов.
    8. Максимальная скорость и ускорение летательного аппарта весом 45 тн: Рекомендуемая скорость в атмосфере - две скорости звука. Максимальная скорость - вторая космическая. В космосе максимальная скорость 99% от скорости света.




    http://nanoworld.org.ru/post/95658/#p95658
    Формы, механизмы, энергия наномира » Putin's Ruby Emdrive
    https://www.facebook.com/permalink.php? … 2351452961
    Кушелев: Как изготавливаются рубиновые источники энергии, рассчитанные на 300 киловатт (для легкового автомобиля). Это было 2 года назад, а ... "наука не стоит на месте":
    http://nanoworld.org.ru/topic/1707/
    Виктор Месогиос: Их удалось запустить-таки?
    Александр Кушелев: Пока что удалось проверить защиту элементов. Сначала в Дубне в 2011 году от ускорителя мощностью 100 мегаватт, а в 2016-ом и 2017-ом годах удалось повторить эксперимент со свечением одного рубинового шарика от импульсного магнетрона на уровне мощности 7 кВт. Так что теперь задача упростилась, а проект удешевился в тысячи раз. Сейчас собираю средства на командировку. Нужно ехать на оборонный завод включать рубиновый источник энергии от магнетрона, от которого уже дважды засветили один рубиновый шарик.
    Виктор Месогиос: а какое время он в 16-17 светился? до нагрева дело дошло?
    Александр Кушелев: Время свечения в 2016-ом году было более 10 секунд, а яркость оценивалась как 15-ваттная лампа накаливания.
    Александр Кушелев: Добротность рубинового резонатора ~50 000, поэтому он сбрасывает лишнюю энергию исключительно в оптическом диапазоне. Он может сам нагреться не более, чем на 1 градус.
    Пока инвесторы собирают по крохам средства на мою командировку (уже третий месяц), я определил по новой технологии более 500 белковых структур: http://nanoworld.org.ru/topic/1699/
    Самым предприимчивым пикотехнология белков принесет триллионы долларов. Если удастся привлечь клиентов, чтобы они сделали пробные заказы за мой счет, то новая технология очень быстро распространится по планете. Ведь старая технология (рентгеноструктурный анализ) не может определить структуры 97% белков даже по триллиону долларов за штуку. А новая может и первые 100 заказов даром smile
    ***
    Виктор Месогиос: то есть свечение продолжалось "в автономном режиме"?
    Александр Кушелев: Учитывая, что скважность сигнала от магнетрона была 3000, импульсная мощность свечения была на уровне 1.5 кВт.
    Александр Кушелев: Нет, это был режим периодического возбуждения резонатора от импульсного магнетрона. Проверялась возможность возбудить резонатор до уровня свечения.
    Александр Кушелев: Теперь вместо одного шарика нужно возбудить рубиновый генератор, состоящий из 3...5 шариков. Он уже создаёт условия преобразования внутренней энергии эфира в колебательную форму. Группа шариков будет работать автономно и день включения будет днем создания рубиновой энергетики. После этого новых инвесторов уже не надо. 7 000 000 000 покупателей получат 10-киловаттные источники энергии через 360 деней. Их готова изготовить одна китайская фабрика.

    http://nanoworld.org.ru/post/95719/#p95719
    леонид дегтярев: Нужно уметь убеждать на бумаге для начала, а потом и устно на деле.
    Александр Кушелев: Китайцы уже убедили на деле: http://nanoworld88.narod.ru/data/621.htm
    Александр Кушелев: Это значит, что китайская спецслужба оказалась круче всех остальных...
    леонид дегтярев: Возможно... а где же НАСА ?
    Александр Кушелев: Ушло в подполье smile


    http://nanoworld.org.ru/post/95870/#p95870
    Формы, механизмы, энергия наномира. Сообщение 92 675
    Putin's Ruby Emdrive
    Инвестор P: Инвесторы, видимо, уже засветили группу шариков, только, как это принято в подобных ситуациях, не спешат оглашать сие даже Вам. А иначе зачем инвестору упражняться с одном шариком аж целых пять раз!?!?
    Кушелев: Инвестор SB следит за новостями на форуме лаборатории Наномир. Он прочёл, что мы с Главным инвестором ездили на Завод, где инвестор И один раз засветил рубиновый шарик, а без него там ещё раз его засветили от того же магнетрона, но на другом модуляторе (тоже ламповом).
    И понял, что устойчивое засвечивание одного шарика очень важно. Иначе можно потерять много времени на изготовление групп шариков. Вот он и добился того, что 5 раз засветил шарик в разные дни. После этого он снова вышел на связь и попросил, чтобы я сделал наборы по 5 шариков. 3 набора. Прислал денег на новый станок. Я станок сделал, а на шарики у него пока нет денег. Он их ждёт уже месяц.
    Самое время быстренько сделать модулятор на базе блокинг-генератора. На той самой модуляторной лампе, которая питает на Заводе магнетрон. Она у меня есть. Есть и конденсатор 0.5 микрофарад 25 киловольт. Это в 5 раз больше, чем на Заводе. От такого простого и надежного модулятора мы сможем включить рубиновый источник энергии хоть в домашней лаборатории. Я скоро узнаю, сколько будет стоить работа. 
    Так что есть удачный момент выйти на финишную прямую ...


    http://nanoworld.org.ru/post/95409/#p95409 
    https://img-fotki.yandex.ru/get/480479/249950893.1/0_16b0af_5928fdb2_orig.jpg

    Эксперименты 2011 года в Дубне повторены на промышленных магнетронах в 2017 году.

     Рубиновые компоненты резонансного супремагнетрона готовы для  сборки и включения рубинового генератора.  





      https://img-fotki.yandex.ru/get/875526/158289418.4b0/0_1885f4_2f2d2e12_XL.png


      mihel-mouse пишет:

      а видеозапись этого эксперимента имеется у Вас, уж больно любопытно было бы глянуть?


      Кушелев: Инвестор, который прислал эту фотку, считает, что даром подобную информацию распространять не нужно. Инвесторы без учета индексации истратили на это исследование больше полмиллиона долларов. Если кто-то хочет получать ответы на вопросы, пусть платит. Можно оптом: http://nanoworld.org.ru/topic/1855/


      Так что извиняйте...






        Kushelev пишет:

        Skype, 2017-12-12:

        [0:01:14] Alexander Alexander: Инвестор SB: да. точно попал
        [01:35:54] Кушелев Александр Юрьевич: А мощность?
        [01:36:14] Инвестор SB: примерно 5 квт
        [01:36:38] Кушелев Александр Юрьевич: Долго режим держался?
        [0:01:19] Alexander Alexander: (dreidel)
        [0:01:33] Alexander Alexander: ЭТО  ЧТО ЗНАЧИТ 5  КВТ  ?
        [0:01:54] Alexander Alexander: ПРИ  ЭТОМ  НАПРЯЖЕНИИ  ШАРИК  ЗАГОРАЕТСЯ ?
        [0:02:28] Alexander Alexander: ИЛИ ЭТО  ШАРИК  ПРОИЗВОДИТ  ЭЛ  НАПРЯЖЕНИЕ ?  В  5  КВТ ?
        [0:13:36] Кушелев Александр Юрьевич: Это импульсная мощность магнетрона

        [0:36:04] Alexander Alexander: аааа...  я уже обрадовался --  что такой  маленький  шарик дает 5 квт....эл энергии...
        [0:37:33] Кушелев Александр Юрьевич: Если бы уже удалось включить, то Вы бы не на форуме, а по центральному ТВ это смотрели. И длинные очереди к офису Главного инвестора...
        [0:39:16] Alexander Alexander: так  что --  в перспективе такое возможно --  что такой  маленький  шарик  или два --  могут давать 10  квт  эл энергии  ???
        [0:39:37] Кушелев Александр Юрьевич: Этот эллипсоид рассчитан на 300 кВт
        [0:40:11] Alexander Alexander: что --  он даст  300  квт  ???
        [0:40:36] Кушелев Александр Юрьевич: Да
        [0:40:47] Alexander Alexander: ОООООООООООООООООООООООООООООО.... ДЕЛАААА..




          [0:42:41] Alexander Alexander: КАК  ЖЕ  НА  ЭТОЙ ЭНЕРГИИ --  ОТ МАЛЕНЬКОГО  РУБИНОВОГО ШАРИКА  СМОЖЕТ ЛЕТАТЬ САМОЛЕТ  ?  ИЛИ ЕХАТЬ ЭЛ АВТОМОБИЛЬ  ?  ИЛИ  КОРАБЛЬ 7
          [0:44:17] Кушелев Александр Юрьевич: Легко. Рубиновый двигатель можно установить прямо на шарик фаркопа:

          http://content-1.foto.my.mail.ru/list/cet/_blogs/i-2465.jpg




            [0:46:02] Alexander Alexander: И....
            [0:46:16] Кушелев Александр Юрьевич: И две кнопки на руле
            [0:46:21] Alexander Alexander: ЭТО БУДЕТ ТОЛКАТЬ АВТО  ??
            [0:46:23] Кушелев Александр Юрьевич: Газ и тормоз
            [0:46:37] Кушелев Александр Юрьевич: Сила тяги до 3 тонн для легковушки
            [0:47:26] Кушелев Александр Юрьевич: В архиве рассылки есть подробности
            [0:47:47] Alexander Alexander: И  КАМАЗ  --  И  ТАНК  --  ТОЖЕ  БУДЕТ ЕХАТЬ ?
            [0:48:04] Кушелев Александр Юрьевич: И самолеты с вертолётами. Это движок "летающей тарелки"
            [0:48:09] Alexander Alexander: В РАССЫЛКЕ  - ТАМ ГОРЫ  ИНФО...
            [0:48:46] Кушелев Александр Юрьевич: Идите сюда: http://m.my.mail.ru/community/3tr/6C6AF794792C3603.html
            [0:48:54] Кушелев Александр Юрьевич: Там для Вас менеджер сделал подборку





              [0:50:18] Alexander Alexander: КУШЕЛЕВ  -- НО ТЫ ЖЕ СВЯЗАН С КИТАЕМ  - ТАМ ТЕБЕ  ВЫТАЧИВАЮТ  ШАРИКИ --  А КИТАЙЦЫ ОХОЧИЕ ДО НОВШЕСТВ  --  ЧТО ЖЕ ОНИ ТЕБЯ НЕ  ЦЕЛУЮТ ВО ВСЕ МЕСТА ?
              [0:50:34] Кушелев Александр Юрьевич: То - другие китайцы
              [0:50:44] Alexander Alexander: ааааааааааааа...
              [0:51:54] Alexander Alexander: так дай  им  задание --  найти кит инвестора  --  лучше  с  правительственными  министерствами..  связали чтоб тебя...
              [0:52:59] Alexander Alexander: они же  задыхаются  в пекине  от  дыма котельных....  им  ты очень нужет  со своей  рубин энергией..
              [0:53:52] Alexander Alexander: они в  масках  в пекине  ходят...
              [1:01:51] Alexander Alexander: (dreidel)
              [1:02:09] Alexander Alexander: посмотрел  -- хооршая  подборка... спасибо.
              [1:02:48] Alexander Alexander: если бы еще  и на английском была  такая же...
              [1:09:23] Alexander Alexander: (dreidel)
              [1:09:28] Alexander Alexander: http://graphenergy.com.au/product/infinity-mg10/
              [1:09:36] Alexander Alexander: (dreidel)
              [1:10:04] Alexander Alexander: вот  создали  БТГ  в  австралии --  но русские  ребята
              [1:10:11] Alexander Alexander: (dreidel)
              [2:19:06] Кушелев Александр Юрьевич: Этот фейк уже разбирался на форуме лаборатории Наномир




              Говорит и показывает Пикотех - апрель 2017. Текущая погрешность модели. Уточнение композиционных углов. Сравнение алгоритмов Кушелева и Соколик.



              Проект Пикотехнология Белков Оналйн


                                                                                                                                                            

              Пикотехнология белков, ДНК, РНК. Часть 1

              Пикотехнология белков, ДНК, РНК. Часть 2   

              Пикотехнология белков, ДНК, РНК. Часть  3



              https://www.ncbi.nlm.nih.gov/protein/74 … SDMTTNU015

              https://www.ncbi.nlm.nih.gov/nuccore/743960172

              >ENA|BAQ14176|complement 2013 nucleotides

              Фрагмент:

              https://img-fotki.yandex.ru/get/235015/158289418.408/0_1789ec_3ca8357b_orig.png

              https://img-fotki.yandex.ru/get/198613/158289418.408/0_1789ed_bab1c6f4_orig.png

              https://img-fotki.yandex.ru/get/114207/158289418.408/0_1789ee_7b85f5c2_orig.png

              Изменение бета- и пи- композиционных углов существенно изменило форму модели фрагмента белка.



              https://www.ncbi.nlm.nih.gov/protein/11 … SDMTTNU015

              https://www.ncbi.nlm.nih.gov/nuccore/1145424954

              >ENA|SJN11245|4035 nucleotides

              Фрагмент:

              https://img-fotki.yandex.ru/get/218038/158289418.408/0_1789f2_e257495e_orig.png

              https://img-fotki.yandex.ru/get/102548/158289418.408/0_1789f3_66042d1b_orig.png

              https://img-fotki.yandex.ru/get/102548/158289418.408/0_1789f4_bb72d67a_orig.png

              Изменение углов бета- и пи-спиралей превратило явно неправильную форму модели в более осмысленную. К сожалению точная настройка углов - дело кропотливое даже с использованием интерактивной версии Пикотех. Так что придётся подождать до её создания...



              https://www.ncbi.nlm.nih.gov/nuccore/292397674

              https://img-fotki.yandex.ru/get/216915/158289418.407/0_178961_995b7be0_orig.png

              Развернуто: https://img-fotki.yandex.ru/get/232875/ … 6_orig.png

              https://img-fotki.yandex.ru/get/102548/158289418.407/0_178962_b6f571b3_orig.png
              Напомню, что наиболее точно показаны углы афльа- и 310-спиралей. Погрешность углов бета- и пи-спиралей может достигать 30 градусов.



              https://www.ncbi.nlm.nih.gov/nuccore/292397674

              Любопытно, что весь геном не содержит ни одного стоп-кодона, т.е. по геному можно собрать один гигантский белок.

              https://img-fotki.yandex.ru/get/218038/ … b_orig.png







              Формы, механизмы, энергия наномира. Сообщение 87 307

              Пикотехнология белков, ДНК, РНК - 3

              Продолжаем исследовать геном: https://www.ncbi.nlm.nih.gov/nuccore/292397674

              https://img-fotki.yandex.ru/get/215803/158289418.408/0_1789bc_b6f420d1_orig.png

              https://img-fotki.yandex.ru/get/41743/158289418.408/0_1789bb_d84905cd_L.png

              https://img-fotki.yandex.ru/get/215803/158289418.408/0_1789bd_349ec7fc_orig.png

              https://img-fotki.yandex.ru/get/94596/158289418.408/0_1789be_b099026e_orig.png

              https://img-fotki.yandex.ru/get/195431/158289418.408/0_1789bf_768bc4e9_orig.png

              https://img-fotki.yandex.ru/get/194492/158289418.408/0_1789c0_b5d5cb01_orig.png

              https://img-fotki.yandex.ru/get/246155/158289418.408/0_1789c1_64997b56_orig.png

              Следующий фрагмент:

              https://img-fotki.yandex.ru/get/230858/158289418.408/0_1789c3_7130a3ff_orig.png

              https://img-fotki.yandex.ru/get/215803/158289418.408/0_1789c2_4b5cf374_L.png

              https://img-fotki.yandex.ru/get/246155/158289418.408/0_1789c4_9a3df7fe_orig.png

              https://img-fotki.yandex.ru/get/25921/158289418.408/0_1789c5_ce0e1d1f_orig.png

              https://img-fotki.yandex.ru/get/104083/158289418.408/0_1789c6_30753229_orig.png

              https://img-fotki.yandex.ru/get/109878/158289418.408/0_1789c7_5ccff731_orig.png

              https://img-fotki.yandex.ru/get/172017/158289418.408/0_1789c8_6ee7e54_orig.png

              https://img-fotki.yandex.ru/get/172017/158289418.408/0_1789c9_7a5c3941_orig.png

              Следующий фрагмент:

              https://img-fotki.yandex.ru/get/54522/158289418.408/0_1789cb_be5f53fb_orig.png

              https://img-fotki.yandex.ru/get/246231/158289418.408/0_1789ca_26e315bb_L.png

              https://img-fotki.yandex.ru/get/194492/158289418.408/0_1789cc_f32b8a9d_orig.png

              https://img-fotki.yandex.ru/get/195990/158289418.408/0_1789cd_c36786fc_orig.png

              https://img-fotki.yandex.ru/get/96803/158289418.408/0_1789ce_cd5b13ea_orig.png

              https://img-fotki.yandex.ru/get/230858/158289418.408/0_1789cf_696dea71_orig.png

              https://img-fotki.yandex.ru/get/215803/158289418.408/0_1789d0_9cad4d65_orig.png

              https://img-fotki.yandex.ru/get/176331/158289418.408/0_1789d1_26f8d604_orig.png

              https://img-fotki.yandex.ru/get/215803/158289418.408/0_1789d2_5cce9287_orig.png

              "Строчка Кушелева" или "вперёд иголочкой 3D" smile

              Кстати, при дальнейшем уточнении композиционных углов может оказаться, что это своеобразная белковая структура "вязание" или "вязь".

              Мы уже встречались с белковой "вязью": http://nanoworld.org.ru/topic/1670/page/3/

              https://img-fotki.yandex.ru/get/177849/158289418.405/0_17875b_f1ed5bdb_XL.gif
              Кстати, при уточнении композиционных углов эта "вязь" может изменить топологию, т.е. петли могут захватывать не одну, а две "нити".



              Формы, механизмы, энергия наномира. Сообщение 87 309

              Письмо Дидье Маруани / Didier Marouani от Кушелева

              Пикотехнология белков, ДНК, РНК - 3

              Открыта музыка белка с размером 7/8 (Lymantria_genom)

              Размер 7/8 интересен тем, что в земной музыке не используется (пока) wink

              https://img-fotki.yandex.ru/get/246231/158289418.408/0_1789ca_26e315bb_XL.png

              https://img-fotki.yandex.ru/get/246231/158289418.408/0_1789d6_dcf8ef5e_orig.png
              Под музыку с музыкальным размером 7/8 строится переходная (спираль-вязь) белковая структура:

              https://img-fotki.yandex.ru/get/195990/158289418.408/0_1789cd_c36786fc_orig.png
              Это ещё спираль, но она уже близка к структуре "псевдовязь".

              https://img-fotki.yandex.ru/get/215803/158289418.408/0_1789d2_5cce9287_orig.png
              Это уже "псевдовязь"

              https://img-fotki.yandex.ru/get/177849/158289418.405/0_17875b_f1ed5bdb_XL.gif
              А это уже "вязь".



              Формы, механизмы, энергия наномира. Сообщение 87 254

              Пикотехнология белков, ДНК, РНК - 3

              Ищем PGAPGAPGAPGAPGAPGAPGAPGAPGAPGAPGA

              https://blast.ncbi.nlm.nih.gov

              https://www.ncbi.nlm.nih.gov/protein/11 … NZ5DF0H014

              https://www.ncbi.nlm.nih.gov/nuccore/1101224483

              OIP72816

              http://molbiol.ru/scripts/01_12.html

              >ENA|OIP72816|complement 228 nucleotides
              atgggtaatagaaacagtttaccttgcctgcctcccggtgctcccggtgctcccggtgct
              cccggtgctcccggtgctcccggtgctcccggtgctcccggtgctcccggtgctcccggc
              gctcccggtgcctcctggtgcccaatcttcccgattccccctcaaatcctttgtaggatc
              ttgttaatcctagaccagtgttggcaaattttctccacttgtttataa

              https://img-fotki.yandex.ru/get/223280/158289418.406/0_178861_4ee3666e_orig.png

              Развернуто: https://img-fotki.yandex.ru/get/218579/ … 0_orig.png

              https://img-fotki.yandex.ru/get/50936/158289418.406/0_17885c_9729af4b_orig.png

              https://img-fotki.yandex.ru/get/97884/158289418.406/0_17885d_9ea5051e_orig.png

              https://img-fotki.yandex.ru/get/50936/158289418.406/0_17885e_e5d06b40_orig.png

              https://img-fotki.yandex.ru/get/243492/158289418.406/0_17885f_539c791e_orig.png

              https://img-fotki.yandex.ru/get/226827/158289418.406/0_178860_659cff44_orig.png


              Кушелев:

              Похоже, что минимальная погрешность у модели со значением угла -30 градусов. Однако нужно учесть, что каждый композитный угол в программе реализован через три ортогональных угла. Из 6 композиционных кодов пока реализовано лишь 4. Не учитываются свойства пролина. А главное, что это геометрический алгоритм, т.е. физико-химические взаимодействия тоже не учитываются.

              Так что пока надёжным результатом программы Пикотех является только вторичная структура белка. Над третичной придётся ещё поработать. Создать интерактивную версию, настроить все композиционные углы, а в следующей версии учесть физико-химические взаимодействия. Тогда пикотехнологические 3D модел белков будут реалистичными. Пока это можно назвать условными 3D-схемами, где отчётливо видны регулярные структуры, но композиционные углы показаны приближённо. Наиболее точно настроен угол альфа-спирали. Углы бета- и пи-спирали настроены с погрешностью до 30 градусов. smile



              Формы, механизмы, энергия наномира. Сообщение 87 229

              Пикотехнология белков, ДНК, РНК - 3

              Программные белковые спирали помогают уточнить композиционные углы

              https://img-fotki.yandex.ru/get/241199/158289418.405/0_17875d_f2a6832c_orig.png
              Неточный композиционный угол пи-спирали приводит к "слипанию" витков программной спирали.

              https://img-fotki.yandex.ru/get/42618/158289418.405/0_17875e_fb9092e0_orig.png
              Варьированием композиционного угла (в скрипте приходится менять три угла, соответствующих одному композиционному коду) можно добиться правильных параметров пи-спирали и программных спиралей, содержащих композиционный код "3".

              https://img-fotki.yandex.ru/get/105284/158289418.405/0_17875c_e1e3ebe9_orig.png

              https://img-fotki.yandex.ru/get/177849/158289418.405/0_17875b_f1ed5bdb_XL.gif

              Более точную настройку композиционных углов можно будет осуществить в интерактивной 3D-версии Пикотех, которую планируется создать.



              Формы, механизмы, энергия наномира. Сообщение 87 173

              Пикотехнология белков, ДНК, РНК - 3

              https://www.ncbi.nlm.nih.gov/protein/64 … CUUFV1Y013

              https://www.ncbi.nlm.nih.gov/nuccore/641581791

              >ENA|CDO63795|14214 nucleotides

              Фрагмент:

              https://img-fotki.yandex.ru/get/217607/158289418.400/0_178553_39d36750_orig.png

              https://img-fotki.yandex.ru/get/48807/158289418.400/0_178555_68349cf2_orig.png

              https://img-fotki.yandex.ru/get/217607/158289418.400/0_178552_b3ebb67c_orig.png

              https://img-fotki.yandex.ru/get/201221/158289418.400/0_178554_22ab089d_orig.png



              Программные белковые спирали помогают уточнить композиционные углы

              Татьяна Рясина пишет:

              Алексанрд Юрьвич, Вам зачот по телепатии
              Хотела спросить, для чего вы удлиняете спирали )))))).
              Может быть Вы, ищете управляющие коды следующего уровня  через принципы  симметрии, что-то вроде языка программирования, который читается через нуклеотидную последовательность.  Слава Богу, всё яснее и проще - сложно это не хорошо )))))).

              Кушелев:

              Я сам не знал, что программные спирали помогут уточнить композиционные углы. Но так получилось...



              Посмотрим, как будет выглядеть модель программной 35-спирали (Q-спирали) при разных значениях одного из трёх компонент композиционного угла пи-спирали.

              https://img-fotki.yandex.ru/get/239438/158289418.405/0_1787f7_5b22868e_orig.png

              https://img-fotki.yandex.ru/get/251308/158289418.405/0_1787fb_da7c81c1_orig.png

              https://img-fotki.yandex.ru/get/239438/158289418.405/0_1787f6_3a7a775c_orig.png

              https://img-fotki.yandex.ru/get/242441/158289418.405/0_1787f8_ea83628b_orig.png
              Первая составляющая композиционного угла = -30 градусов.

              https://img-fotki.yandex.ru/get/102548/158289418.405/0_1787fa_6059c2bc_orig.png

              https://img-fotki.yandex.ru/get/242441/158289418.405/0_1787f9_bdf8bbc_orig.png

              https://img-fotki.yandex.ru/get/202427/158289418.405/0_1787fc_65fe6898_orig.png
              -20 градусов

              https://img-fotki.yandex.ru/get/50936/158289418.405/0_1787fd_3f3ef421_orig.png

              https://img-fotki.yandex.ru/get/239438/158289418.405/0_1787ff_ec74f186_orig.png
              -10 градусов

              https://img-fotki.yandex.ru/get/104700/158289418.405/0_178800_6eedd5a0_orig.png
              -5 градусов

              https://img-fotki.yandex.ru/get/194858/158289418.405/0_178801_89256618_orig.png

              https://img-fotki.yandex.ru/get/194835/158289418.405/0_17880a_761f2886_orig.png
              -30

              https://img-fotki.yandex.ru/get/246231/158289418.405/0_178802_acc3b5d7_orig.png
              -30

              https://img-fotki.yandex.ru/get/249782/158289418.405/0_178809_945f4a83_orig.png
              -20

              https://img-fotki.yandex.ru/get/194835/158289418.405/0_178803_7b9385e2_orig.png
              -20

              https://img-fotki.yandex.ru/get/108697/158289418.405/0_178808_b13d30dc_orig.png
              -10

              https://img-fotki.yandex.ru/get/216915/158289418.405/0_178804_9a2ba4c7_orig.png
              -10

              https://img-fotki.yandex.ru/get/143523/158289418.405/0_178807_ab063ec1_orig.png
              -5

              https://img-fotki.yandex.ru/get/244791/158289418.405/0_178806_931bf82d_orig.png
              -5

              https://img-fotki.yandex.ru/get/242441/158289418.405/0_178805_e2aa47d8_orig.png
              -5

              Осталось выбрать наиболее правильную модель. Для этого нужно узнать экспериментальные значения числа аминокислотных остатков на виток Q-спирали, радиус и шаг спирали. Возможно, что эти данные уже имеются в Protein Data Base...



              Формы, механизмы, энергия наномира. Сообщение 87 250

              Пикотехнология белков, ДНК, РНК - 3

              Программные белковые спирали помогают уточнить композиционные углы

              Продолжаем уточнять композиционные углы...

              http://subscribe.ru/archive/science.new … 2016.html/

              https://img-fotki.yandex.ru/get/246231/158289418.405/0_178802_acc3b5d7_orig.png

              https://img-fotki.yandex.ru/get/242441/158289418.405/0_178805_e2aa47d8_orig.png

              Кушелев: Здесь видно, что изменение одной из составляющих угла пи-спирали с -30 до -5 градусов меняет правую 35-спираль (Q-спираль) на левую. А это значит, что можно провести сравнительно дешёвый эксперимент с измерением вращения поляризации света в растворе, содержащим Q-спираль белка. Эксперимент поможет выяснить, является ли Q-спираль правой или левой. А вместе с этим определится и композиционный угол пи-спирали. Хотя модельный эксперимент может оказаться ещё проще и дешевле.

              http://www.nanoworld.org.ru/data/01/data/avi/bio.gif




              Пикотехнология белков, ДНК, РНК - 3

              https://www.ncbi.nlm.nih.gov/protein/59 … GY7BKE3014

              https://www.ncbi.nlm.nih.gov/nuccore/597863140

              EYC12612

              http://molbiol.ru/scripts/01_12.html

              >ENA|EYC12612|complement 978 nucleotides
              atggcgcataagaactacacaatatactactactactactactactactactactactac
              tactactactactactactactactactactactactactactactactactactactac
              tactactactactactactactactactactactactactactactactactactactac
              tactactactactactactactactactactactactactactactactactactactac
              tactactactactactactactactactactactactactactactactactactactac
              tactactactactactactactactactactactactactactactactactactactac
              tactactactactactactactactactactactactactactactactactactactac
              tactactactactactactactactactactactactactactactactactactactac
              tactactactactactactactactactactactactactactactactactactactac
              tactactactactactactactactactactactactactactactactactactactac
              tactactactactactactactactactactactactactactactactactactactac
              tactactactactactactactactactactactactactactactactactactactac
              tactactactactactactactactactactactactactactactactactactactac
              tactactactactactactactactactactactactactactactactactactactac
              tactactactactactactactactactactactactactactactactactactactac
              tactactactactactactactactactactactactactactactactactactactac
              tactactactactactaa

              https://img-fotki.yandex.ru/get/194549/158289418.405/0_1786df_87810cd1_orig.png

              Развернуто: https://img-fotki.yandex.ru/get/57797/1 … 8_orig.png

              https://img-fotki.yandex.ru/get/25921/158289418.405/0_1786e0_966a7f3_orig.png

              https://img-fotki.yandex.ru/get/470815/158289418.405/0_1786e1_1d124a65_orig.png

              https://img-fotki.yandex.ru/get/196631/158289418.405/0_1786e2_df2cfdc9_orig.png

              https://img-fotki.yandex.ru/get/402270/158289418.405/0_1786e3_6321e951_orig.png

              Это достаточно длинный (более 300 аминокислотных остатков), но не рекордный прямой участок альфа-спирали белка, состоящий только из Tyr (остатков тирозина)

              Напомню, что рекорд для прямого участка альфа-спирали 502 аминокислотных остатка: http://subscribe.ru/archive/science.new … 0048.html/

              https://img-fotki.yandex.ru/get/196365/158289418.3ff/0_1784e9_d77a01c0_orig.png



              Формы, механизмы, энергия наномира. Сообщение 87 173

              Пикотехнология белков, ДНК, РНК - 3

              https://www.ncbi.nlm.nih.gov/protein/64 … CUUFV1Y013

              https://www.ncbi.nlm.nih.gov/nuccore/641581791

              >ENA|CDO63795|14214 nucleotides

              Удлиним фрагмент:

              https://img-fotki.yandex.ru/get/228104/158289418.400/0_178557_3b1bfac4_orig.png

              https://img-fotki.yandex.ru/get/52461/158289418.400/0_17855b_d5df9b2d_orig.png

              https://img-fotki.yandex.ru/get/196258/158289418.400/0_178556_64e20c4e_orig.png

              https://img-fotki.yandex.ru/get/194858/158289418.400/0_178558_4cfb6d65_orig.png

              Эта программная 52332233-спираль вдоль оси симметрии выглядит, как "цветик-семицветик" smile

              https://img-fotki.yandex.ru/get/52461/158289418.400/0_17855e_5a0316e1_orig.png

              https://img-fotki.yandex.ru/get/218038/158289418.400/0_17855a_c0e8de1d_orig.png

              https://img-fotki.yandex.ru/get/196258/158289418.401/0_178564_9003769e_orig.png

              https://img-fotki.yandex.ru/get/104403/158289418.401/0_178565_fb4b46d1_orig.png

              Рассмотрим второй подфрагмент и удлиним.

              https://img-fotki.yandex.ru/get/195990/158289418.401/0_178568_b38ec28b_orig.png

              https://img-fotki.yandex.ru/get/48807/158289418.401/0_17856c_85398970_orig.png

              https://img-fotki.yandex.ru/get/194503/158289418.401/0_178569_1d5d111a_orig.png

              https://img-fotki.yandex.ru/get/195990/158289418.401/0_178570_3158aa34_orig.png

              https://img-fotki.yandex.ru/get/366459/158289418.401/0_178571_ba2c38c4_orig.png

              https://img-fotki.yandex.ru/get/105020/158289418.401/0_17857c_e4d780df_orig.gif

              И ещё один фрагмент:

              https://img-fotki.yandex.ru/get/94596/158289418.401/0_178573_1ace1da6_orig.png

              https://img-fotki.yandex.ru/get/170749/158289418.401/0_178577_49931586_orig.png


              https://img-fotki.yandex.ru/get/231315/158289418.401/0_178574_49adec25_orig.png

              https://img-fotki.yandex.ru/get/114207/158289418.401/0_178576_6473b15d_orig.png

              https://img-fotki.yandex.ru/get/99813/158289418.401/0_178578_9474ae93_orig.png

              https://img-fotki.yandex.ru/get/170749/158289418.401/0_178579_ec130458_orig.png

              https://img-fotki.yandex.ru/get/226123/158289418.401/0_17857a_b0d3e989_orig.png

              https://img-fotki.yandex.ru/get/96803/158289418.401/0_17857b_f9093be0_orig.png

              В белковых спиралях ось симметрии обычно бывает дробного, иррационального, действительного порядка. При этом водородные связи могут образоваться с каждым вторым, третьим, четвертым... аминокислотным остатком.



              Формы, механизмы, энергия наномира. Сообщение 87 183

              Пикотехнология белков, ДНК, РНК - 3

              https://www.ncbi.nlm.nih.gov/nuccore/641581791


              Удлиним...

              https://img-fotki.yandex.ru/get/53993/158289418.401/0_1785d8_b5d96945_orig.png

              https://img-fotki.yandex.ru/get/108697/158289418.402/0_1785db_90802362_orig.png


              https://img-fotki.yandex.ru/get/55231/158289418.402/0_1785da_aefd87c7_orig.png

              https://img-fotki.yandex.ru/get/105020/158289418.402/0_1785d9_8168b4b_orig.png

              https://img-fotki.yandex.ru/get/25921/158289418.402/0_1785d6_e8bedd97_orig.gif


              Ещё удлиним...


              https://img-fotki.yandex.ru/get/46400/158289418.402/0_1785e1_b3714b2c_orig.png

              https://img-fotki.yandex.ru/get/53078/158289418.402/0_1785de_ea5af989_orig.png

              https://img-fotki.yandex.ru/get/108697/158289418.402/0_1785df_7a71cb36_orig.png

              https://img-fotki.yandex.ru/get/105020/158289418.402/0_1785e0_722837dd_orig.png

              https://img-fotki.yandex.ru/get/225029/158289418.402/0_1785e2_2f67004f_orig.png

              https://img-fotki.yandex.ru/get/105020/158289418.402/0_1785e3_2247a57d_orig.png

              https://img-fotki.yandex.ru/get/225029/158289418.402/0_1785e4_cf77b2dd_orig.png

              https://img-fotki.yandex.ru/get/225029/158289418.402/0_1785e5_35c2f872_orig.png

              https://img-fotki.yandex.ru/get/196161/158289418.402/0_1785e6_657310bf_orig.png

              https://img-fotki.yandex.ru/get/196161/158289418.402/0_1785e7_90f8bdec_orig.png

              https://img-fotki.yandex.ru/get/53145/158289418.402/0_1785e8_1bd0e109_orig.png

              https://img-fotki.yandex.ru/get/196161/158289418.402/0_1785e9_f8bf81e0_orig.png

              https://img-fotki.yandex.ru/get/96803/158289418.402/0_1785ea_20449840_orig.png

              https://img-fotki.yandex.ru/get/105020/158289418.402/0_1785eb_d93fb41c_orig.png

              https://img-fotki.yandex.ru/get/228104/158289418.402/0_1785ec_16e6f898_orig.png
              Один фрагмент белковой молекулы сложнее, чем "календарь" Майя smile




              Пикотехнология белков, ДНК, РНК - 3

              https://www.ncbi.nlm.nih.gov/protein/70 … CUUFV1Y013

              https://www.ncbi.nlm.nih.gov/nuccore/700200443

              >ENA|KGN58390|complement 3366 nucleotides

              https://img-fotki.yandex.ru/get/105020/158289418.401/0_178592_1df41495_orig.png


              https://img-fotki.yandex.ru/get/111568/158289418.401/0_178595_b21ee814_orig.png


              https://img-fotki.yandex.ru/get/232875/158289418.401/0_178593_9513dcee_orig.png

              https://img-fotki.yandex.ru/get/212758/158289418.401/0_178594_25ef477a_orig.png

              Фрагмент:

              https://img-fotki.yandex.ru/get/141254/158289418.401/0_178584_f27fcbd_orig.gif

              Вторичная структура полностью: https://img-fotki.yandex.ru/get/170815/ … 0_orig.gif



              Пикотехнология белков, ДНК, РНК - 3

              Кушелев: Регулярные белковые молекулы (программные спирали) помогают сравнить разные алгоритмы определения вторичной структуры:

              https://img-fotki.yandex.ru/get/61897/158289418.401/0_17857d_3145a1c1_orig.gif

              https://img-fotki.yandex.ru/get/105020/158289418.401/0_17857c_e4d780df_orig.gif

              https://img-fotki.yandex.ru/get/219501/158289418.401/0_17857e_ac49feb3_orig.gif

              https://img-fotki.yandex.ru/get/198998/158289418.401/0_178566_e89d1890_orig.png

              https://img-fotki.yandex.ru/get/141254/158289418.401/0_178584_f27fcbd_orig.gif
              Вторичная структура полностью: https://img-fotki.yandex.ru/get/170815/ … 0_orig.gif


              Рассмотрим ещё один фрагмент этого белка: https://www.ncbi.nlm.nih.gov/nuccore/641581791

              https://img-fotki.yandex.ru/get/198569/158289418.400/0_178551_85a4502d_orig.png

              Фрагмент:

              https://img-fotki.yandex.ru/get/195431/158289418.401/0_17858d_ef73e04c_orig.png

              https://img-fotki.yandex.ru/get/239438/158289418.401/0_178588_29e022_orig.png

              https://img-fotki.yandex.ru/get/366459/158289418.401/0_178589_8de3c4f7_orig.png

              https://img-fotki.yandex.ru/get/56406/158289418.401/0_17858a_2281070b_orig.png

              https://img-fotki.yandex.ru/get/104595/158289418.401/0_17858b_7ebf07b5_orig.png

              https://img-fotki.yandex.ru/get/249782/158289418.401/0_17858c_6baa98e5_orig.png

              Эта структура тоже помогает сравнить разные алгоритмы:

              https://img-fotki.yandex.ru/get/198613/158289418.401/0_17858f_4805b4d6_orig.png



              https://www.ncbi.nlm.nih.gov/protein/92 … NZ5DF0H014

              https://www.ncbi.nlm.nih.gov/nuccore/921130435

              >ENA|XP_013439753|1851 nucleotides
              atgagagcagcagcagcagcaaaggcagcaaacctggcgggcgacagggccgcgtggggc
              ccccccgcagcagcagcagcagcagcagcagcagcagcgcctgctgcgccgccagcagca
              gcaggaggcgaagtgctgcagcagctgctgtcggcggcgctgagccgcttcgagggcctc
              gccctcgagcgcatgcaaagctatgtgcagcaggagtggggcccccggcagcagcagctg
              cagcaggaagcaaataaagcagcagacttgaacttggccttattggaggccctggacttg
              gacaaactcagcacagaagacctgcaggcagttctttctttgtccgaagacatccagcgc
              caggggcccccctccgaggcagcagcagcggcccggggggccccccggggcccccggggc
              ccccgggggggggcccccacagcccgcagcagcagcagcgggggccccccagtctttgcc
              cagtcctgctgcggccggcccggccgcccgcagggcccagagggggcccccagcggcctg
              gcctcgccggggctgctggggggcccccaggggggccccctggggggcccccaggggagc
              ccgctggggggcccccaggggggccccctggggggccccctgggggcccccaacgaggaa
              ctggctggggcccccacggacttcgttgtgaccccccggggctccattagagaagcttct
              gctgccttgaggcactggagagacttgctggactatatggatgaaagagatggctttttg
              gacatgttgcggggcagcgaaagtggcagagacgtggggtgtacgtacaccccaggcggg
              cggcgggcccaggggcggcgcgcggctgcaaagggcaaagaaagaactgctgcagacaag
              gcagcgagcccccccacggggtccgcagcagcagcagcagcagcagctgctgcagcagca
              gcagcagcaggggaggcagcagcagcagaagccggcgcggggggccccacgggcgcctcc
              gcgctggctgctgctgctgctgctgctgctgctgctgctggcctcatcgactgcagcaac
              ggcaaagccagcccctcggctctcagcagcagggcctcccgccggcggtctcgccaagtg
              ctgcagaagaaagcaggaggttcgaaggacttctcgggggcccccctcgagggggtcgag
              tggcccgagggggcccccggaaagaggcactgcccggggtctccctgcagccgcttctcc
              gcattatgcgaggcttgcgagggcctcgcaagtcccccggggttggctgtggggtctgct
              gctgctgctgctgctgctgctgctgcggatgccgcgtacctgtggccgcaggggcccgag
              cgcagcagcagcagcagcagcagcagcagcagcagcagcggggcggccggcgcagcgcag
              gagggggggcccccgcccccactcgcccgcggcagcttcgcgggcaagaagggcccccgg
              ggggcccccgcgagcagcagacaaaggtgtttgtcccccttgtgtctcgacgacatgctc
              aaaatcgtctggggggcccccagggaggccgcagcccttattctcaacgacgcgcagcca
              ggggccccaggggccccaggggccccaggggccccaggggccccgggggccccgggggcc
              ccgggggccccgggggccccgggggccccgggggcttcaggggcttcaggggccccgggg
              gccccgggggcttcaggggcccctggggcccccaaagaggccctttgtgttggccggaaa
              gcggcagcgccttttggaaatgagcagtgctgctccgttaaggaggagtag

              https://img-fotki.yandex.ru/get/165720/158289418.406/0_178867_d1ff26b5_orig.png

              Развернуто: https://img-fotki.yandex.ru/get/167717/ … d_orig.png

              Фрагмент:

              https://img-fotki.yandex.ru/get/249078/158289418.406/0_178868_6ae8c6fc_orig.png
              Этот фрагмент собирается в темпе вальса. В смысле в темпе коллагена smile
              См. полный комплект файлов: https://cloud.mail.ru/public/5S1m/okiNUfhhx

              https://img-fotki.yandex.ru/get/229553/158289418.406/0_178869_786c1239_orig.png

              https://img-fotki.yandex.ru/get/225029/158289418.406/0_17886a_82ea4a62_orig.png

              https://img-fotki.yandex.ru/get/59977/158289418.406/0_17886b_cf6e7d5b_orig.png

              https://img-fotki.yandex.ru/get/230858/158289418.406/0_17886c_a323f9d6_orig.png

              https://img-fotki.yandex.ru/get/230858/158289418.406/0_17886d_749c7d93_orig.png

              Точнее всего скорее модель с величиной угла 30 градусов.




              https://www.ncbi.nlm.nih.gov/protein/11 … NZ5DF0H014

              https://www.ncbi.nlm.nih.gov/nuccore/1127494923

              >ENA|OLL84536|complement 408 nucleotides
              gtgccacccgtccagccacccgggttcagcgagttggtgcacgccccgacccggctgtcg
              ctgctgtcgctgctctcggccaccgaccggatcgagttcgggctgcttcgcgacggcctg
              gcgctgtcggactcggccttgtccaagcagctgggcatcctggaggaggccgggctggtg
              gcgttggagcgcgacggtgtggggcgcgggaagcgggtgcgtgtgcgcatgaccgacagt
              ggtcggcggaccttcgacgaccacgtcgccgcgctgcaggtcatcgtgcgccgcggcgcc
              cccggcgcccccggcgcccccggcgcccccggcgcccccggcgcccccggcgcccccggc
              gcccccggcgcccccggcgctccctcgcagtccacgtccgcgagctga

              https://img-fotki.yandex.ru/get/218038/158289418.406/0_17886f_b26ad3cc_orig.png

              Развернуто: https://img-fotki.yandex.ru/get/118251/ … 3_orig.png

              https://img-fotki.yandex.ru/get/218038/158289418.406/0_178870_cb6be9a0_orig.png

              https://img-fotki.yandex.ru/get/28561/158289418.406/0_178871_e451602c_orig.png

              Точнее, вероятно, с углом 30, но нужно уточнять дальше, причём все композиционные углы.






              Кольцегранные электроны и ядра, модели атомов, молекул и химия

              Kushelev пишет:

              Атомы меди имеют один валентный электрон. Из этих электронов и образуется электронная кольцегранная поверхность димера, тримера и тетрамера.

              Понятие валентности настолько неопределенно и противоречиво, что химики от него давно отказались. А если и используют, то только для удобства классификации. Например, какая валентность натрия и хлора в кристалле хлористого натрия? Там каждый атом натрия связан с шестью атомами хлора. А валентность железа в молекуле ферроцена? В ней атом железа связан с 10 атомами углерода, и все связи одинаковые. А валентность бора в тетраборане В4Н10? У водорода всего один электрон, но при температуре 14К кристаллы твердого водорода имеют гексагональную сингонию. И таких примеров миллион. Так что физический смысл имеет только степень окисления.



              Денис пишет:

              Понятие валентности настолько неопределенно и противоречиво, что химики от него давно отказались.

              Кушелев: Верно. А понятие "валентные электроны" продолжает использоваться. Вы же говорите "атмосфера", хотя знаете, что никакой твёрдой небесной сферы с закреплёнными на ней звёздами не существует. Я тоже понимаю, что теория валентности устарела, но электроны, участвующие в образовании химических соединений, можно называть валентными, подразумевая не теорию валентности, а степень окисления.

              http://www.nanoworld.org.ru/data/01/data/avi/na-cl.gif
              Подробнее: http://www.nanoworld.org.ru/data/01/data/avi/_index.htm

              У меня есть пикотехнологическая модель NaCl. Валентный электрон Na достраивает внешнюю оболочку Cl до 8. Далее ионы складываются в кристалл. Кстати, вокруг каждого иона хлора не 6, а 8 ионов натрия на одинаковом расстоянии. Но при этом по 6 ионов хлора на одинаковом расстоянии.


              Денис пишет:

              А валентность железа в молекуле ферроцена? В ней атом железа связан с 10 атомами углерода, и все связи одинаковые.

              Что касается ферроцена, то у меня есть и его пикотехнологическая модель:

              http://www.nanoworld.org.ru/data/20040222/20040527/nad_ferrocene.files/2004052301.jpg
              Подробнее:

              Цитата:

              http://www.piramida-maxima.ru/issues/20 … lekso.html

              В 1951 году Кили и Посоном был получен ферроцен (С5Н5)2Fe (cхема 1).
              Это открытие явилось началом развития всей металлоорганической химии
              переходных металлов и, в частности, обширного класса сэндвичевых
              соединений (за исследование этого класса соединений в 1973 году
              Уилкинсон и Фишер получили Нобелевскую премию). Сэндвичевые
              соединения построены из атома переходного металла, зажатого между
              двумя циклическими лигандами (в случае ферроцена: атом железа -
              как бы начинка сэндвича, а циклопентадиенильные кольца - куски хлеба).

              Для определения сравнительной устойчивости подобных структур было
              сформулировано правило 18 электронов [2]. Оно гласит, что соединение
              является кинетически устойчивым, если суммарное число валентных
              электронов металла и лигандов равно 18. При этом в ферроцене атом
              железа имеет 8 электронов, а циклопентадиенильные лиганды -
              5 электронов; итого: 8 + 2*5 =18.
              Конец цитаты.

              Кушелев: Кольцегранная модель ферроцена объясняет высокую устойчивость этого
              металлоорганического соединения образованием 18-гранной электронной оболочки
              и 8 водородных связей между электронами этой оболочки и сопряжёнными
              системами C5H4- .

              При этом правило 18-ти электронов приобретает физический смысл, т.к. речь
              идёт об образовании 18-гранной электронной оболочки.


              Пикотехнологическая модель орто-карборана

              Цитата:

              http://www.piramida-maxima.ru/issues/20 … lekso.html

              В 1963 году две группы исследователей сообщили о получении орто-карборана С2В10Н12 (схема 2). Это соединение имеет строение правильного икосаэдра из 10 вершин ВН и двух вершин СН.
              Строение подобных соединений было подробно рассмотрено Липскомбом (за что он получил Нобелевскую премию в 1976 году).

              Конец цитаты.

              Кушелев: Существующие модели молекул с пятиричной симметрией противоречат принципу Паули, что на классическом языке означает нарушение чередования магнитных полюсов электронов, т.е. кольцевые магниты могут образовать на плоскости только чётные циклы, т.е. из чётного числа кольцевых магнитов.

              Предлагаемые мною модели (фуллеренов, сопряжённых системы C5H5, ферроцена, орто-карборана и др.) лишены этого недостатка.

              http://www.nanoworld.org.ru/data/20040222/20040527/nad_carboran.files/2004052351.jpg

              Соединение сопряжённой (многослойной) электронной структуры углерода с
              сопряженной электронной структурой бора, как показывает моя пикометрическая модель, действительно даёт угол, близкий к углу между гранями 12-гранника (додекаэдра). Как же построить модель не нарушая принципа Паули?

              http://www.nanoworld.org.ru/data/20040222/20040527/nad_carboran.files/2004052352.jpg

              На этой иллюстрации мы видим, что симметрия додекаэдра возможна без нарушения(!) принципа Паули. Дело в том, что радиусы внешних электронов углерода и бора несколько отличаются. Ещё больше отличаются от них радиус электрона водорода. Это приводит к тому, что между одноимёнными полюсами кольцевых электронов есть зазоры как в 32-х электронной оболочке с пятиричной симметрией. Эти зазоры и делают сопряжённую систему устойчивой.

              http://physics.nad.ru/img/2004052353.jpg (эту картинку можно посмотреть, но я её не показываю, чтобы не перегружать Ваш траффик)
              Следует отметить, что смагничиваются как внешние (электроны водорода), так и внутренние (электроны углерода и бора, т.е. 12-гранная фигура получается смагниченной как бы из усечённых конусов, представляющих в действительности многослойные электронные структуры сопряжённых атомов углерода и бора.

              http://www.nanoworld.org.ru/data/20040222/20040527/nad_carboran.files/2004052354.jpg

              Эта модель проливает свет и на более экзотичные химические соединения, например, дикарболлид-дианион, дианионный комплекс [(С2В9Н11)2Fe]2-, являющийся металлакарборановым аналогом ферроцена.


              Денис пишет:

              А валентность бора в тетраборане В4Н10?

              Кушелев: Естественно, что речь идёт об образовании общей электронной оболочки молекулы, как, например, в молекулы 4-атомного фосфора (см. рис. ниже)



              Денис пишет:

              У водорода всего один электрон, но при температуре 14К кристаллы твердого водорода имеют гексагональную сингонию.

              Кушелев: А при определённом давлении и температуре водород становится металлом...

              Чтобы смоделировать эти экзотические состояния вещества, нужно учитывать не только форму электрона, но и другие его свойства. Например, зависимость радиуса от окружающих элементарных частиц.



              Пикотехнология белков, ДНК, РНК - 2

              Подробнее: http://nanoworld88.narod.ru/data/493.htm

              VAK пишет:

              Не сочтите за труд, расскажите нам, о чем написано в тексте ниже, взятого из оригинальной статьи журнала?

              Кушелев: Не можете перевести на русский? Точно иностранный диверсант. Вас и окончания слов типа "взятого" выдают с головой...

              Ловите перевод:

              Kushelev: The second row (B,F,J) shows the AFM signal (frequency shift) recorded in constant-current topographic imaging with a CO-terminated tip. The dark spots in the flat regions correspond to Cu surface atoms that allow us to register the lattice overlay in the third row (C,G and K). The last row (D,H and L) shows the proposed adsorption sites, indicating top, fcc and hcp positions. An adatom centered on a fcc site thus continues the bulk fcc structure, whereas an adatom on a hcp site would break the crystalline order of the bulk. DFT calculations (21) reveal that dimers (D) adsorb with the two Fe atoms close to next-nearest bridge sites. On-top centered trimers (H) also adsorb with the three Fe atoms close to bridge sites, and tetramers (L) absorb on fcc sites. The top row and the rows below show different clusters.

              Кушелев: Вторая строка (B, F, J) показывает сигнал AFM (сдвиг частоты), записанный при  топографической съемке в режиме постоянного тока с CO-наконечником. Темные пятна в плоских участках соответствуют поверхности атомов Cu, с наложенной решёткой в третьем ряду (C, G и K). Последняя строка (D, H и L) показывает предполагаемые участки адсорбции, что указывает на вершину в ГЦК и ГПУ позиции. Адсорбированный атом находится в центре участка ГЦК, продолжая объемную структуру ГЦК, в то время как адсобрированный атом на участке ГПУ нарушил бы кристаллический порядок основной массы. Расчеты DFT (21) показывают, что адсорбированные димеры (D) состоят из двух атомов Fe, связанных с ближайшими атомами решётки. Тримеры в центре илл. (H) связаны с тремя ближайшими атомами Fe решётки. Тетрамеры (L) находятся на сайтах ГЦК. В разных рядах показаны разные кластеры.

              Кушелев: Атомы меди имеют один валентный электрон. Из этих электронов и образуется электронная кольцегранная поверхность димера, тримера и тетрамера.

              http://www.nanoworld.org.ru/data/01/data/images/models/molecule/p4_02.jpg

              http://img-fotki.yandex.ru/get/5807/nanoworld2003.2c/0_50542_7543dc7c_XL.png

              Взгляните на кольцегранную модель молекулы четырехатомного фосфора. Она тоже имеет молекулярную кольцегранную оболочку. Общую для 4 атомов.


              Изучайте современную химию и физику. И будет Вам счастье tongue


              http://img-fotki.yandex.ru/get/5812/126580004.7/0_aaaf4_9fd81ee2_M.jpghttp://img-fotki.yandex.ru/get/4813/126580004.7/0_aaa3e_a854fe1a_M.jpg

              http://img-fotki.yandex.ru/get/4412/126580004.7/0_aaa3f_40815c3d_M.jpghttp://img-fotki.yandex.ru/get/5014/126580004.7/0_aaa40_a6a95285_M.jpg

              Подробнее: http://nanoworld88.narod.ru/data/250.htm



              Сказочный Дмитров ...

              Кушелев: Я бы предложил не просто сделать в Дмитрове сказочный городок с использованием высоких технологий из лаборатории Наномир, а поставить вопрос о превращении Дмитрова в наукоград. Дело в том, что пикотехнология, например, не требует специального оборудования. Определять структуры белковых молекул пикотехнологи смогут на домашних компьютерах. А искать заказы на структуры белковых молекул менеджеры могут через интернет, т.е. тоже не выходя из дома.

              Подробнее о пикотехнологии:

              http://nanoworld.org.ru/topic/301/

              http://nanoworld.org.ru/topic/297/page/67/

              http://img-fotki.yandex.ru/get/5506/126580004.42/0_b37ab_6493b0b7_S.gifhttp://img-fotki.yandex.ru/get/9116/158289418.af/0_ae267_2d0606e3_orig.gif




              Анатолий Шестопалов пишет:

              На анимации показана самосборка из эфира элементарных частиц -> атомов -> молекул.

              Кушелев: Я на этой анимации вижу сборку электронных оболочек из колец-электронов.

              Для сборки ядер из нуклонов интересно сделать другую анимацию. В фильме "Путешествие в наномир" есть анимация, но не очень зрелищная:

              http://www.nanoworld.org.ru/data/01/data/avi/quark.gif

              http://www.nanoworld.org.ru/data/01/data/images/slides/travel/0110.jpg http://www.nanoworld.org.ru/data/01/data/images/slides/travel/0109.jpg

              http://www.nanoworld.org.ru/data/01/data/images/slides/travel/0167.jpg

              http://www.nanoworld.org.ru/data/01/data/images/slides/travel/0108.jpg

              http://www.nanoworld.org.ru/data/01/data/images/slides/travel/0171.jpg
              Подробнее: http://www.nanoworld.org.ru/data/01/dat … index1.htm

              Там действительно идёт речь о ядрах, о разборке и сборке атомного ядра из нуклонов.


              Ангкор Ватом и Мачу Пикчу - палеоконтакт, который не возможно не видеть

              Kushelev пишет: Ярослав Старухин пишет:

              FaceBook: https://www.facebook.com/photo.php?fbid … mp;theater

              Туристическая Камбоджа известна пляжами , Ангкор Ватом , ступенчатой пирамидой и рекой тысяча лингамов . До сих пор нет единой версии, кто и для чего строил загадочные сооружения . И если сооружения на земле сейчас гиды и официальная наука приписывают к религиозно культовым объектам, то дать ответ , кто дно реки превратил во фрактальные магнетроны, никто не может . Побывав лично , поддерживаю версию Кушелева А.Ю., руководителя лаборатории НАНОМИР, что сооружения и конструкции в реке, являются остатками магнетронов - технологических процессов по добыче редких рассеянных элементов , инопланетными геологическими экспедициями по всей планете. Версия конечно поражает воображение , но схожесть и похожесть технологий по всей планете , внезапное исчезновение тех, кто владел подобным технологиями и наличие по всей планете , карьеров и гор- отвалов земляной породы , а так же последние достижения науки в области Холодного ядерного синтеза и модели трансмутирования элементов везде вокруг нас, позволят рассматривать подобную, первоначально кажущуюся фантастической версию о палео контакте.
              Знания в данной области имеют практическое значение и позволяют России из отсталого - четвертого технологического уклада , перейти в опережающий наших коллег за рубежом , технологический уклад и занять лидирующие позиции и в области фундаментальных исследований и в области практического применения .
              Подробности в этих и следующих видео сюжетах.


              https://img-fotki.yandex.ru/get/198860/158289418.3c0/0_17031a_7c30264c_XL.jpg

              https://img-fotki.yandex.ru/get/196548/158289418.3c0/0_17031b_3ee8ea37_XL.jpg

              https://img-fotki.yandex.ru/get/198017/158289418.3c0/0_17031c_ac60e20c_XL.jpg

              https://img-fotki.yandex.ru/get/145691/158289418.3c0/0_17031d_af96e14a_XL.jpg

              https://img-fotki.yandex.ru/get/196548/158289418.3c0/0_17031e_eb9abdb3_XL.jpg

              https://img-fotki.yandex.ru/get/199051/158289418.3c0/0_17031f_ed92af7b_XL.jpg

              https://img-fotki.yandex.ru/get/198017/158289418.3c0/0_170320_6cb92b3f_XL.jpg

              https://img-fotki.yandex.ru/get/198026/158289418.3c0/0_170321_a635976b_XL.jpg

              Кушелев: Так держать, Ярослав Петрович!

              Да, классно! Пора с Ярославом в Перу лететь smile



              Формы, механизмы, энергия наномира. Сообщение 84 473

              Когда и на чём лететь в Перу?

              Upgrade пишет:

              Да, классно! Пора с Ярославом в Перу лететь smile

              Кушелев: Тут есть нюансы.

              1. Для эффективности экспедиций нужна дополнительная аппаратура. Измерительная и, скажем, квадрокоптер, камера для подводных съёмок, аппаратура для возможности проведения интерактивной экспедиции, т.е. онлнайн трансляций из мегалитического комплекса. Тогда эффективность сильно возрастёт. Возможность взять пробы воды, растений, грунта и провести их масс-спектральный анализ тоже увеличит эффективность.

              2. Летать на самолётах - слишком большой риск. Я уже писал в рассылке и на форуме, что полёт на самолёте в 200 раз опаснее поездки на поезде. Я считаю, что это - неоправданный риск.

              3. Сконцентрировав силы и средства на внедрении пикотехнологии и на включении рубинового источника энергии можно получить на порядки больше эффект, чем от очередной экспедиции с исследованием мегалитов.

              4. Найти заинтересованных людей, чтобы вернуть молодость планете, позволит "растянуть удовольтствие от путешествий (и не только!) до бесконечности".




              Формы, механизмы, энергия наномира. Сообщение 84 499

              Татьяна Рясина пишет:

              Там лама делал золото "без всего",  "из ума".

              Кушелев: Этот фокус мы знаем smile

              https://img-fotki.yandex.ru/get/195559/158289418.3c3/0_170a25_ec1bc9a9_XL.jpg

              Только инопланетяне это могут по-настоящему, но не "без всего", а с помощью "скатерти-самобранки", т.е. 3D-печати субатомного уровня. А есть и более простая технология.

              http://img-fotki.yandex.ru/get/9328/158289418.113/0_d5b72_3733b93f_XL.gif
              На человека производит впечатление инопланетная технология добычи драгметаллов, в т.ч. золота. Кажется, что золото "делается без всего", но на самом деле оно просто поднимается с поверхности земли электрическим полем. Создаётся монохроматичный луч в рентгеновском диапазоне. Атомы золота, сконцентрированные водой и растениями ионизируются. Ионы вытягиваются электрическим полем и собираются в золотой слиток. Это и для современного человека - чудо smile



              Формы, механизмы, энергия наномира. Сообщение 84 491

              Готовится 586-ой выпуск рассылки "Новости лаборатории Наномир"

              http://subscribe.ru/catalog/science.news.nanoworldnews

              Дайджест:

              586 Заявки на научные открытия.
              Явление взаимодействия токов проводимости и смещения с эфиром Фарадея-Максвелла.
              Обнаружены дисульфидные мостики Met-Cys!
              Композиционный код 6
              Экспедиция к крупнейшему выпаривательному комплексу Ват и реке 1000 магнетронов.
              https://img-fotki.yandex.ru/get/107080/158289418.3c1/0_17055a_3780cb13_XL.jpg

              Открытие относится к области эфиронавтики. Техническим результатом является работа электромагнитного двигателя, резонатора "Рыбьей / Змеиной волны", который токами проводимости или смещения отталкивается от носителя электромагнитных колебаний / волн, т.е. от светоносного эфира Фарадея-Максвелла. Конструкция двигателя может быть простой, как крест или уголок, а может быть фрактальной. Энергию из эфира лучше добывать на высокой частоте, а отталкиваться на низкой, чтобы амплитуда токов проводимости или смещения была максимальной. http://nanoworld.narod.ru




              Формы, механизмы, энергия наномира. Сообщение 84 459

              Принцип движения НЛО (Денис)

              Денис пишет:

              силы Ампера между двумя проводниками всегда направлены встречно или диаметрально противоположно в зависимости от направления тока.

              Кушелев: Вы просто не в курсе, как действуют силы на участки проводников smile
              Компенсация получается в квазистатике. Аналогичная компенсация получается, если змея формирует на своём теле стоячую волну. В этом случае она не поплывёт и не поползёт.

              http://img-fotki.yandex.ru/get/3004/nanoworld.a1/0_18af4_c204a3e_orig.gif




              https://img-fotki.yandex.ru/get/198998/158289418.3c1/0_17066a_325fac7_orig.png
              https://img-fotki.yandex.ru/get/98619/158289418.3c3/0_1706b3_7dab967d_orig.gif
              https://img-fotki.yandex.ru/get/194425/158289418.3c0/0_170319_680a11a3_XL.jpg




              Макчу-Пикчу

              https://img-fotki.yandex.ru/get/170749/158289418.3c1/0_17066b_91a5768_XL.jpg

              https://img-fotki.yandex.ru/get/105284/158289418.3c1/0_17066c_c97bc2f8_XL.jpg

              https://img-fotki.yandex.ru/get/60436/158289418.3c2/0_17066d_15a98910_XL.jpg

              https://img-fotki.yandex.ru/get/197102/158289418.3c1/0_17066e_8bcfa100_XL.jpg

              https://img-fotki.yandex.ru/get/196245/158289418.3c1/0_17066f_5846a6e7_XL.jpg

              https://img-fotki.yandex.ru/get/61164/158289418.3c2/0_170670_550fd223_XL.jpg

              https://img-fotki.yandex.ru/get/95108/158289418.3c2/0_170671_13e29d3a_XL.jpg

              https://img-fotki.yandex.ru/get/196548/158289418.3c2/0_170672_824c4021_XL.jpg

              https://img-fotki.yandex.ru/get/166206/158289418.3c2/0_170673_3e42b114_XL.jpg

              https://img-fotki.yandex.ru/get/197700/158289418.3c2/0_170674_cd7fe404_XL.jpg

              https://img-fotki.yandex.ru/get/59613/158289418.3c2/0_170675_c766b9aa_XL.jpg

              https://img-fotki.yandex.ru/get/62989/158289418.3c2/0_170676_16ae244d_XL.jpg

              https://img-fotki.yandex.ru/get/62989/158289418.3c2/0_170677_6e2cf3ff_XL.jpg

              https://img-fotki.yandex.ru/get/59613/158289418.3c2/0_170678_21158f5_XL.jpg

              https://img-fotki.yandex.ru/get/52656/158289418.3c2/0_170679_a7a5995a_XL.jpg

              https://img-fotki.yandex.ru/get/214545/158289418.3c2/0_17067a_1d4f72c4_XL.jpg
              Своеобразный ступенчатый диэлектрический переход...

              https://img-fotki.yandex.ru/get/166206/158289418.3c2/0_17067b_881877aa_XL.jpg

              https://img-fotki.yandex.ru/get/101645/158289418.3c2/0_17067c_a413b5fb_XL.jpg


              https://img-fotki.yandex.ru/get/49312/158289418.3c2/0_17067d_e4632ce6_XL.jpg

              https://img-fotki.yandex.ru/get/55633/158289418.3c2/0_17067e_59ccb4c_XL.jpg

              https://img-fotki.yandex.ru/get/244791/158289418.3c2/0_17067f_53c0fdee_XL.jpg

              https://img-fotki.yandex.ru/get/49312/158289418.3c2/0_170680_6238a35e_XL.jpg

              https://img-fotki.yandex.ru/get/104403/158289418.3c2/0_170681_37c16a79_XL.jpg

              https://img-fotki.yandex.ru/get/197700/158289418.3c2/0_170682_80fd3509_XL.jpg




              https://img-fotki.yandex.ru/get/197700/158289418.3c2/0_170683_302a221_XL.jpg

              https://img-fotki.yandex.ru/get/44819/158289418.3c2/0_170684_fac59e56_XL.jpg

              https://img-fotki.yandex.ru/get/115272/158289418.3c2/0_170685_e15413f6_XL.jpg

              https://img-fotki.yandex.ru/get/105284/158289418.3c3/0_1706a3_b01986a1_XL.png


              https://img-fotki.yandex.ru/get/194858/158289418.3c2/0_170686_73aab82d_XL.jpg
              Стены с трубопроводами внутри ассоциируются с теплообменниками Баальбека. Похоже, что и здесь мы видим технологию обеспечения рекуперации тепловой энергии.

              Или что-то другое? Может быть это типа "рубашки водяного охлаждения", чтобы "движок не перегрелся"?

              https://img-fotki.yandex.ru/get/197700/158289418.3c2/0_170687_81936433_XL.jpg

              https://img-fotki.yandex.ru/get/118982/158289418.3c2/0_170688_ff85a815_XL.jpg

              https://img-fotki.yandex.ru/get/47776/158289418.3c2/0_170689_50bef70_XL.jpg

              https://img-fotki.yandex.ru/get/137468/158289418.3c2/0_17068a_200a500a_XL.jpg

              https://img-fotki.yandex.ru/get/198860/158289418.3c2/0_17068b_1b66de4d_XL.jpg

              https://img-fotki.yandex.ru/get/96803/158289418.3c2/0_17068c_9c706d0d_XL.jpg

              https://img-fotki.yandex.ru/get/198786/158289418.3c2/0_17068d_b270557e_XL.jpg

              https://img-fotki.yandex.ru/get/194588/158289418.3c2/0_17068e_eba00d59_XL.jpg


              https://img-fotki.yandex.ru/get/194588/158289418.3c2/0_17068f_d2b3a3f2_XL.jpg

              https://img-fotki.yandex.ru/get/105284/158289418.3c2/0_170690_59e19a51_XL.jpg

              https://img-fotki.yandex.ru/get/194858/158289418.3c2/0_170691_30066b31_XL.jpg

              https://img-fotki.yandex.ru/get/215803/158289418.3c2/0_170692_3c320513_XL.jpg

              https://img-fotki.yandex.ru/get/50936/158289418.3c2/0_170693_5a048e29_XL.jpg

              https://img-fotki.yandex.ru/get/118982/158289418.3c2/0_170694_a99c3a72_XL.jpg

              https://img-fotki.yandex.ru/get/244791/158289418.3c2/0_170695_4b772acf_XL.jpg

              https://img-fotki.yandex.ru/get/49312/158289418.3c2/0_170696_8aaaead0_XL.jpg

              https://img-fotki.yandex.ru/get/31690/158289418.3c2/0_170697_5e6bd346_XL.jpg

              https://img-fotki.yandex.ru/get/197700/158289418.3c2/0_170698_26f61303_XL.jpg

              https://img-fotki.yandex.ru/get/118982/158289418.3c2/0_170699_84c296e5_XL.jpg

              https://img-fotki.yandex.ru/get/41717/158289418.3c2/0_17069a_31b3b4c6_XL.jpg

              https://img-fotki.yandex.ru/get/44085/158289418.3c2/0_17069b_a5bf0bbd_XL.jpg

              https://img-fotki.yandex.ru/get/198786/158289418.3c2/0_17069c_d0dd0b2b_XL.jpg

              https://img-fotki.yandex.ru/get/49312/158289418.3c2/0_17069d_955a6afb_XL.jpg

              https://img-fotki.yandex.ru/get/52446/158289418.3c2/0_17069e_37d14e55_XL.jpg

              https://img-fotki.yandex.ru/get/60881/158289418.3c2/0_17069f_eff1e2d7_XL.jpg

              https://img-fotki.yandex.ru/get/194858/158289418.3c2/0_1706a0_18f30d59_XL.jpg

              https://img-fotki.yandex.ru/get/225650/158289418.3c3/0_1706a1_23ec0a55_XL.jpg

              https://img-fotki.yandex.ru/get/198786/158289418.3c3/0_1706a2_a0798330_XL.jpg




              Пикотех - коррелляция первичной последовательности и вторичной структуры белка

              Формы, механизмы, энергия наномира. Сообщение 84 388

              Пикотехнология белков, ДНК, РНК - 2

              http://www.rcsb.org/pdb/explore/explore … ureId=2ND1

              http://www.uniprot.org/uniprot/O60885

              http://www.ebi.ac.uk/ena/data/view/AAL26987

              >ENA|AAL26987|AAL26987.1 Homo sapiens (human) bromodomain-containing 4
              ATGTCTGCGGAGAGCGGCCCTGGGACGAGATTGAGAAATCTGCCAGTAATGGGGGATGGA
              CTAGAAACTTCCCAAATGTCTACAACACAGGCCCAGGCCCAACCCCAGCCAGCCAACGCA
              GCCAGCACCAACCCCCCGCCCCCAGAGACCTCCAACCCTAACAAGCCCAAGAGGCAGACC
              AACCAACTGCAATACCTGCTCAGAGTGGTGCTCAAGACACTATGGAAACACCAGTTTGCA
              TGGCCTTTCCAGCAGCCTGTGGATGCCGTCAAGCTGAACCTCCCTGATTACTATAAGATC
              ATTAAAACGCCTATGGATATGGGAACAATAAAGAAGCGCTTGGAAAACAACTATTACTGG
              AATGCTCAGGAATGTATCCAGGACTTCAACACTATGTTTACAAATTGTTACATCTACAAC
              AAGCCTGGAGATGACATAGTCTTAATGGCAGAAGCTCTGGAAAAGCTCTTCTTGCAAAAA
              ATAAATGAGCTACCCACAGAAGAAACCGAGATCATGATAGTCCAGGCAAAAGGAAGAGGA
              CGTGGGAGGAAAGAAACAGGGACAGCAAAACCTGGCGTTTCCACGGTACCAAACACAACT
              CAAGCATCGACTCCTCCGCAGACCCAGACCCCTCAGCCGAATCCTCCTCCTGTGCAGGCC
              ACGCCTCACCCCTTCCCTGCCGTCACCCCGGACCTCATCGTCCAGACCCCTGTCATGACA
              GTGGTGCCTCCCCAGCCACTGCAGACGCCCCCGCCAGTGCCCCCCCAGCCACAACCCCCA
              CCCGCTCCAGCTCCCCAGCCCGTACAGAGCCACCCACCCATCATCGCGGCCACCCCACAG
              CCTGTGAAGACAAAGAAGGGAGTGAAGAGGAAAGCAGACACCACCACCCCCACCACCATT
              GACCCCATTCACGAGCCACCCTCGCTGCCCCCGGAGCCCAAGACCACCAAGCTGGGCCAG
              CGGCGGGAGAGCAGCCGGCCTGTGAAACCTCCAAAGAAGGACGTGCCCGACTCTCAGCAG
              CACCCAGCACCAGAGAAGAGCAGCAAGGTCTCGGAGCAGCTCAAGTGCTGCAGCGGCATC
              CTCAAGGAGATGTTTGCCAAGAAGCACGCCGCCTACGCCTGGCCCTTCTACAAGCCTGTG
              GACGTGGAGGCACTGGGCCTACACGACTACTGTGACATCATCAAGCACCCCATGGACATG
              AGCACAATCAAGTCTAAACTGGAGGCCCGTGAGTACCGTGATGCTCAGGAGTTTGGTGCT
              GACGTCCGATTGATGTTCTCCAACTGCTATAAGTACAACCCTCCTGACCATGAGGTGGTG
              GCCATGGCCCGCAAGCTCCAGGATGTGTTCGAAATGCGCTTTGCCAAGATGCCGGACGAG
              CCTGAGGAGCCAGTGGTGGCCGTGTCCTCCCCGGCAGTGCCCCCTCCCACCAAGGTTGTG
              GCCCCGCCCTCATCCAGCGACAGCAGCAGCGATAGCTCCTCGGACAGTGACAGTTCGACT
              GATGACTCTGAGGAGGAGCGAGCCCAGCGGCTGGCTGAGCTCCAGGAGCAGCTCAAAGCC
              GTGCACGAGCAGCTTGCAGCCCTCTCTCAGCCCCAGCAGAACAAACCAAAGAAAAAGGAG
              AAAGACAAGAAGGAAAAGAAAAAAGAAAAGCACAAAAGAAAAGAGGAAGTGGAAGAGAAT
              AAAAAAAGCAAAGCCAAGGAACCTCCTCCTAAAAAGACGAAGAAAAATAATAGCAGCAAC
              AGCAATGTGAGCAAGAAGGAGCCAGCGCCCATGAAGAGCAAGCCCCCTCCCACGTATGAG
              TCGGAGGAAGAGGACAAGTGCAAGCCTATGTCCTATGAGGAGAAGCGGCAGCTCAGCTTG
              GACATCAACAAGCTCCCCGGCGAGAAGCTGGGCCGCGTGGTGCACATCATCCAGTCACGG
              GAGCCCTCCCTGAAGAATTCCAACCCCGACGAGATTGAAATCGACTTTGAGACCCTGAAG
              CCGTCCACACTGCGTGAGCTGGAGCGCTATGTCACCTCCTGTTTGCGGAAGAAAAGGAAA
              CCTCAAGCTGAGAAAGTTGATGTGATTGCCGGCTCCTCCAAGATGAAGGGCTTCTCGTCC
              TCAGAGTCGGAGAGCTCCAGTGAGTCCAGCTCCTCTGACAGCGAAGACTCCGAAACAGAG
              ATGGCTCCGAAGTCAAAAAAGAAGGGGCACCCCGGGAGGGAGCAGAAGAAGCACCATCAT
              CACCACCATCAGCAGATGCAGCAGGCCCCGGCTCCTGTGCCCCAGCAGCCGCCCCCGCCT
              CCCCAGCAGCCCCCACCGCCTCCACCTCCGCAGCAGCAACAGCAGCCGCCACCCCCGCCT
              CCCCCACCCTCCATGCCGCAGCAGGCAGCCCCGGCGATGAAGTCCTCGCCCCCACCCTTC
              ATTGCCACCCAGGTGCCCGTCCTGGAGCCCCAGCTCCCAGGCAGCGTCTTTGACCCCATC
              GGCCACTTCACCCAGCCCATCCTGCACCTGCCGCAGCCTGAGCTGCCCCCTCACCTGCCC
              CAGCCGCCTGAGCACAGCACTCCACCCCATCTCAACCAGCACGCAGTGGTCTCTCCTCCA
              GCTTTGCACAACGCACTACCCCAGCAGCCATCACGGCCCAGCAACCGAGCCGCTGCCCTG
              CCTCCCAAGCCCGCCCGGCCCCCAGCCGTGTCACCAGCCTTGACCCAAACACCCCTGCTC
              CCACAGCCCCCCATGGCCCAACCCCCCCAAGTGCTGCTGGAGGATGAAGAGCCACCTGCC
              CCACCCCTCACCTCCATGCAGATGCAGCTGTACCTGCAGCAGCTGCAGAAGGTGCAGCCC
              CCTACGCCGCTACTCCCTTCCGTGAAGGTGCAGTCCCAGCCCCCACCCCCCCTGCCGCCC
              CCACCCCACCCCTCTGTGCAGCAGCAGCTGCAGCAGCAGCCGCCACCACCCCCACCACCC
              CAGCCCCAGCCTCCACCCCAGCAGCAGCATCAGCCCCCTCCACGGCCCGTGCACTTGCAG
              CCCATGCAGTTTTCCACCCACATCCAACAGCCCCCGCCACCCCAGGGCCAGCAGCCCCCC
              CATCCGCCCCCAGGCCAGCAGCCACCCCCGCCGCAGCCTGCCAAGCCTCAGCAAGTCATC
              CAGCACCACCATTCACCCCGGCACCACAAGTCGGACCCCTACTCAACCGGTCACCTCCGC
              GAAGCCCCCTCCCCGCTTATGATACATTCCCCCCAGATGTCACAGTTCCAGAGCCTGACC
              CACCAGTCTCCACCCCAGCAAAACGTCCAGCCTAAGAAACAGGAGCTGCGTGCTGCCTCC
              GTGGTCCAGCCCCAGCCCCTCGTGGTGGTGAAGGAGGAGAAGATCCACTCACCCATCATC
              CGCAGCGAGCCCTTCAGCCCCTCGCTGCGGCCGGAGCCCCCCAAGCACCCGGAGAGCATC
              AAGGCCCCCGTCCACCTGCCCCAGCGGCCGGAAATGAAGCCTGTGGATGTCGGGAGGCCT
              GTGATCCGGCCCCCAGAGCAGAACGCACCGCCACCAGGGGCCCCTGACAAGGACAAACAG
              AAACAGGAGCCGAAGACTCCAGTTGCGCCCAAAAAGGACCTGAAAATCAAGAACATGGGC
              TCCTGGGCCAGCCTAGTGCAGAAGCATCCGACCACCCCCTCCTCCACAGCCAAGTCATCC
              AGCGACAGCTTCGAGCAGTTCCGCCGCGCCGCTCGGGAGAAAGAGGAGCGTGAGAAGGCC
              CTGAAGGCTCAGGCCGAGCACGCTGAGAAGGAGAAGGAGCGGCTGCGGCAGGAGCGCATG
              AGGAGCCGAGAGGACGAGGATGCGCTGGAGCAGGCCCGGCGGGCCCATGAGGAGGCACGT
              CGGCGCCAGGAGCAGCAGCAGCAGCAGCGCCAGGAGCAACAGCAGCAGCAGCAACAGCAA
              GCAGCTGCGGTGGCTGCCGCCGCCACCCCACAGGCCCAGAGCTCCCAGCCCCAGTCCATG
              CTGGACCAGCAGAGGGAGTTGGCCCGGAAGCGGGAGCAGGAGCGAAGACGCCGGGAAGCC
              ATGGCAGCTACCATTGACATGAATTTCCAGAGTGATCTATTGTCAATATTTGAAGAAAAT
              CTTTTCTGA

              Композиционный код:

              1,3,4,1,1,1,3,4,4,3,1,3,3,4,2,2,1,4,3,2,2,3,3,1,3,1,3,2,2,1,1,1,1,3,1,1,2,1,1,2,1,1,1,1,1,4,1,2,1,1,
              1,1,3,1,1,1,1,1,1,1,1,3,4,3,1,4,1,3,4,4,1,1,2,2,1,3,1,1,3,2,1,3,1,1,1,3,4,3,1,1,1,4,1,1,3,3,1,3,1,1,
              3,3,4,3,1,3,1,2,2,2,1,1,1,1,3,1,1,3,1,1,3,3,1,3,3,1,1,1,1,1,3,1,3,2,3,3,1,1,1,1,1,3,2,3,1,2,1,3,1,2,
              3,3,4,3,1,1,1,1,3,3,2,3,1,2,1,2,3,3,1,1,1,1,2,1,1,2,3,2,3,2,3,4,1,3,3,2,4,2,2,3,3,1,3,1,4,2,2,1,2,3,
              3,2,4,3,3,4,1,1,1,1,3,1,4,3,3,3,3,4,1,1,4,3,1,1,1,3,1,1,1,4,1,1,1,1,1,1,3,1,1,2,4,4,3,1,1,2,4,1,4,1,
              4,2,4,1,1,1,2,3,1,2,1,3,2,3,1,1,1,2,1,1,1,2,1,1,1,4,1,1,2,1,3,4,1,2,1,1,2,4,1,1,3,2,1,1,1,1,1,1,1,3,
              1,1,3,1,1,2,1,4,4,1,4,1,1,1,1,1,1,4,1,1,4,4,1,1,1,4,3,4,3,3,2,1,1,1,4,1,1,3,1,1,1,2,2,2,1,1,1,1,1,1,
              4,1,1,1,1,1,1,1,1,1,1,1,1,1,3,1,1,1,1,1,1,1,1,1,1,1,1,1,3,4,1,4,1,2,4,1,2,1,1,1,3,1,1,1,1,1,1,1,1,1,
              1,2,1,1,3,3,4,1,1,3,1,1,3,3,3,1,1,3,3,3,1,1,2,1,1,1,1,1,1,3,1,1,1,3,3,1,3,1,4,4,1,1,1,1,1,1,1,3,4,1,
              3,1,1,3,1,1,1,4,1,1,3,1,1,2,4,4,1,4,1,1,4,2,4,1,3,1,1,1,3,4,1,4,1,2,1,1,1,1,1,1,3,1,1,4,1,3,1,3,4,3,
              3,1,3,1,1,1,2,1,1,4,4,3,1,1,1,1,1,1,3,1,4,1,1,1,3,2,1,1,3,1,1,1,1,1,3,2,1,3,1,1,3,1,1,1,3,1,3,3,3,1,
              1,3,3,3,1,3,4,3,1,3,3,3,1,3,1,1,3,3,3,3,3,1,4,1,3,3,3,1,1,1,1,3,4,1,1,1,1,2,4,1,1,1,1,1,1,3,1,4,3,1,
              4,1,3,1,1,1,1,1,3,1,1,3,1,1,1,4,1,1,1,1,1,1,1,1,1,1,1,1,1,4,1,1,4,4,1,1,1,1,2,4,1,1,1,4,1,3,1,1,1,1,
              1,3,3,1,1,3,1,1,4,1,4,1,2,4,3,1,4,1,1,3,1,1,1,3,1,4,1,3,1,3,3,3,3,1,3,3,3,4,3,1,1,1,1,1,1,1,1,1,4,1,
              2,1,4,1,1,1,3,1,1,1,1,3,1,1,3,1,1,3,2,1,1,3,4,1,2,3,1,1,4,1,1,4,1,1,1,1,1,1,3,3,1,1,3,1,1,1,1,1,1,4,
              3,3,4,1,1,1,4,1,4,3,1,1,1,1,2,4,3,2,3,4,1,1,3,1,1,4,2,1,4,3,1,2,1,1,1,4,1,1,2,1,4,4,1,1,1,4,1,2,1,1,
              3,1,1,1,4,1,1,4,1,1,1,1,2,1,1,1,3,1,1,1,1,1,1,1,1,1,1,4,1,4,4,1,3,1,4,1,3,1,4,1,1,4,3,1,1,1,3,2,1,3,
              1,1,1,1,2,4,1,3,3,2,3,1,1,1,2,2,1,1,1,2,2,4,1,1,1,2,1,3,1,4,3,1,1,1,1,4,1,2,1,4,2,2,1,1,1,3,2,1,4,1,
              2,1,1,1,1,1,3,1,1,3,4,4,4,1,3,3,1,2,3,1,2,1,1,1,1,1,1,1,1,4,1,4,1,1,4,1,1,4,1,1,3,4,4,2,1,3,1,4,1,4,
              1,1,1,1,2,1,1,4,4,1,2,1,1,1,3,4,1,1,1,4,1,1,1,4,2,2,1,2,2,1,1,1,1,3,2,1,1,1,1,3,1,1,3,2,4,1,4,1,1,1,
              1,1,1,3,1,1,1,1,3,1,1,4,2,1,1,1,1,1,1,1,3,4,1,2,1,1,1,2,1,4,4,1,3,1,1,3,1,3,1,1,1,1,1,3,2,1,4,1,1,1,
              4,1,1,1,2,1,3,1,1,1,3,1,1,1,4,3,1,2,3,1,1,1,1,2,1,1,1,1,4,1,1,1,3,2,1,1,3,1,1,1,3,1,3,1,1,4,3,3,1,1,
              4,1,1,1,1,1,1,4,4,4,1,1,1,1,1,1,2,1,1,1,1,1,1,1,1,1,1,4,4,4,4,1,1,1,1,1,4,1,1,1,1,1,1,1,1,4,1,1,4,4,
              3,1,1,3,4,3,1,4,1,3,4,1,4,1,2,1,1,1,2,4,2,2,4,1,3,1,1,1,3,1,3,1,1,4,1,3,2,3,4,1,3,1,1,4,3,1,1,1,1,1,
              1,1,1,1,2,4,1,1,3,4,1,1,1,1,1,2,1,1,2,1,1,1,1,1,1,1,1,1,1,1,3,4,1,3,1,1,3,1,1,1,4,1,3,1,1,1,1,3,1,1,
              1,1,1,4,4,4,1,1,1,1,1,1,2,1,1,1,3,4,4,1,1,1,4,4,1,3,1,1,2,3,4,1,1,1,1,1,1,1,1,1,1,1,3,1,1,1,1,3,1,3,
              2,3,4,4,3,1,1,1,1,2,1,1,1,1,1,1,1,1,1,1,4,1,1,1,1,1,1,1,4,1,4,1,1,1,2,3,1,4,3,1,1,2,3,1,3,1,1,3,1,1,
              3,3,2,1,2,2,3,3,3,3,3,1

              Вторичная структура (Пикотех): https://img-fotki.yandex.ru/get/195419/ … 4_orig.gif

              https://img-fotki.yandex.ru/get/122076/158289418.3bf/0_170243_1d83303d_orig.png
              Кушелев: Любопытный фрагмент структуры...

              https://img-fotki.yandex.ru/get/224193/158289418.3bf/0_170244_9266a9c0_orig.png

              https://img-fotki.yandex.ru/get/95629/158289418.3bf/0_170245_af9b706f_orig.png

              https://img-fotki.yandex.ru/get/198488/158289418.3bf/0_170246_38a453a9_orig.png

              https://img-fotki.yandex.ru/get/196142/158289418.3bf/0_170247_b39cbdc0_orig.png

              https://img-fotki.yandex.ru/get/43388/158289418.3bf/0_170248_c78de507_orig.png

              Кушелев: Интересно, что это за участки белка такие необычные?

              https://img-fotki.yandex.ru/get/196486/158289418.3bf/0_17025e_97b8bb30_orig.png
              Кушелев: Обратите внимание на корреляцию вторичной структуры с аминокислотными остатками. Gln (глутамин) находится в структуре прямой альфа-спирали, а Pro (пролин) в структуре бета-спирали и краёв.



              Формы, механизмы, энергия наномира. Сообщение 84 389

              Пикотехнология белков, ДНК, РНК - 2

              https://img-fotki.yandex.ru/get/196486/158289418.3bf/0_17025e_97b8bb30_orig.png
              Кушелев: Все видят корреляцию?

              https://img-fotki.yandex.ru/get/196010/158289418.3bf/0_17027c_adf3ee8_orig.png
              Такая корреляция наглядно показывает предсказательную силу пикотехнологии даже на уровне 2D-структуры.

              https://img-fotki.yandex.ru/get/61266/158289418.3bf/0_17027d_df19ad12_orig.png

              https://img-fotki.yandex.ru/get/197923/158289418.3bf/0_17028e_455c9b30_orig.png

              https://img-fotki.yandex.ru/get/195637/158289418.3bf/0_1702b1_a19e23f8_orig.png

              https://img-fotki.yandex.ru/get/114207/158289418.3bf/0_1702b2_8171e69d_orig.png

              https://img-fotki.yandex.ru/get/55918/158289418.3bf/0_1702b3_c5186377_orig.png

              Кушелев: Корреляция вторичной структуры по таблице композиционного кода с первичной последовательностью белка, в частности, иминокислоты Pro, очевидна.


              А первичная последовательность в отличие от данных РСА имеет 100%-ную надёжность smile




              Кратко о принципе действия рубинового генератора и о возможностях составного резонатора. Следите за новостями на Форуме Лаборатории Наномир!




              ОБОСНОВАНИЕ ЭКСПЕРИМЕНТОВ

              МОДЕЛЬНЫЕ ПРЕДСТАВЛЕНИЯ ЛАБОРАТОРИИ НАНОМИР

              http://nano-world-articles.nethouse.ru/page/1024882 




              http://nanoworld.org.ru/topic/1477/page/12/ 

              Новости рубиновой / микроволновой энергетики и транспорта

              http://globalwave.tv/forum/viewtopic.ph … 636#p19636

              Dmitry пишет:

              Если поймёте суть данного генератора

              Кушелев:

              Я прошёл через этот этап в начале 90-ых годов. Понял, что извлечь энергию из эфира можно за счёт задержки, которая определяется скоростью света. После этого стало понятно, что магнитные поля должны двигаться с субсветовой скоростью, чтобы получилось разумное соотношение мощности к массе. Поэтому от постоянных магнитов я перешёл к катушкам типа трансформатора Теслы, а потом стал уменьшать число витков, чтобы усилить эффект. Минимальное число витков катушки реализовано в современном магнетроне:


              http://img-fotki.yandex.ru/get/51/nanoworld.88/0_e5ed_5b0a546e_L.jpg


              Резонаторный блок состоит из неполных одиночных витков.


              http://img-fotki.yandex.ru/get/3312/nanoworld.e7/0_255aa_3df72b92_L.jpg


              Супермагнетрон-источник энергии можно делать из проводников, но это в домашних условиях сложно. Разработка новой модели магнетрона даже в заводских условиях обходится заказчику типа миллиона долларов.


              http://img-fotki.yandex.ru/get/3211/nanoworld.e7/0_255ab_3f62392_L.gif
              Поэтому с проводящих супермагнетронов я переключился на диэлектрические, которые легко делать в домашних условиях


              http://img-fotki.yandex.ru/get/4423/126580004.33/0_af0af_b828ac5a_L.png

              http://nanoworld.org.ru/data/01/data/images/slides/20011007/g02a.jpg


              Осталось включить готовый супермагнетрон, но ... не тут-то было! Наша цивилизация так слаба, что даже этого не может сделать годами.

              Мне удавалось добираться до подходящей аппаратуры, "но только один раз". Второй попытки, как правило уже не было. Тогда я придумал создать номинальный ряд источников энергии, чтобы можно было включить его с одной попытки, но цена такого ряда оказалась для инвесторов неподъёмной,т.е. около 45 000 USD.


              Тогда я придумал, как удешевить номинальный ряд, заменив группы шариков:


              https://img-fotki.yandex.ru/get/15557/158289418.1a0/0_10250c_b17f5f00_orig.jpg


              На монокристаллические генераторы:


              http://nanoworld88.narod.ru/data/475_files/0_1279ae.jpg


              Но тут выяснилось, что для их работы нужны дополнительные зеркала...


              https://img-fotki.yandex.ru/get/54004/158289418.2da/0_153f53_9def447d_orig.jpg


              Подробнее: http://nanoworld.org.ru/post/72636/#p72636


              А сегодня я могу собрать резонатор, например, на частоту микроволновки из рубинового конструктора и медных зеркал:


              https://img-fotki.yandex.ru/get/44085/158289418.370/0_166077_df71d2ee_XL.jpg

              https://img-fotki.yandex.ru/get/143523/158289418.370/0_166075_72ec8967_XL.jpg


              Подробнее: http://nanoworld.org.ru/topic/1128/page/58/


              Вам я пытаюсь помочь не задерживаться на этапе "постоянные магниты". Для этого Вы можете изготовить дешёвый маленький действующий макет и убедиться, что ожидаемого Вами эффекта нет. Но если Вам хочется тратить жизнь на ожидание крупных инвесторов, а потом испытывать большой провал, то что я могу поделать? "Насильно мил не будешь" smile

              https://img-fotki.yandex.ru/get/15539/158289418.1c8/0_115ac7_66dabfb9_XL.jpg
              Подробнее: http://nanoworld.org.ru/topic/1041/




              http://nanoworld.org.ru/post/77855/#p77855 

              Татьяна Рясина пишет:

              В данном случае мы имеем дело с океаном эфира , который даёт энергию, но не поглощает

              Кушелев: Может давать и поглощать. Оба процесса могут регулироваться в широких пределах. Например, за пределами рубинового шарика СВЧ поле может практически не излучаться, т.е. на каждом цикле колебаний материал резонатора может поглощать 1 / 10 000 000 000 часть запасённой энергии, а излучать ещё меньше.

              https://img-fotki.yandex.ru/get/20/nanoworld.5/0_8876_c9c9755e_orig.jpg


              Подробнее: https://fotki.yandex.ru/next/users/nano … view/34934


              https://img-fotki.yandex.ru/get/196161/158289418.371/0_1662ed_5dac8e9d_orig.gif


              Процесс главным образом локализован внутри диэлектрических волноводов. Кольцо почти прислоняется к линейному волноводу. Вспомогательные боксы кончаются там, где поле практически отсутствует.



              Формы, механизмы, энергия наномира. Сообщение 81 237

              http://globalwave.tv/forum/viewtopic.ph … 789#p19789

              Dmitry пишет:

              а Вам необходимо подучиться!

              Кушелев:

              Ага, чтобы так же, как и Вы считать, что поле за пределами рубинового резонатора - глюк программы HFSS:


              http://nanoworld88.narod.ru/data/431_files/0_6ae4_8.png




              Формы, механизмы, энергия наномира. Сообщение 81 238

              http://globalwave.tv/forum/viewtopic.ph … 791#p19791

              Dmitry пишет:Kushelev пишет:

              Кушелев: Ага, чтобы так же, как и Вы считать, что поле за пределами рубинового резонатора - глюк программы HFSS:

              Dmitry

              Надо не с программами работать, а с практическими моделями, что бы реально видеть свой результат!

              Кушелев:

              Вы просто не в теме:


              http://www.nanoworld.org.ru/data/05/20021213/001.jpg


              Подробнее: http://nanoworld.org.ru/topic/740/page/29/


              Я провожу эксперименты и знаю, что программы HFSS и CST показывают то, что есть в эксперименте.

              А по Вашему модельному представлению рубиновый шарик, у которого часть поля находится за пределами рубина, резонировать не может. Так что Вам предстоит нелёгкий выбор. Либо отказаться от ошибочных модельных представлений, либо продолжать жить в мире иллюзий smile




              Принцип движения НЛО (Денис)

              Денис пишет:

              Если поместить сапфировые, а еще лучше рубиновые изделия в микроволновку, то они засветятся.

              Кушелев:


              https://img-fotki.yandex.ru/get/53993/158289418.2e3/0_15586d_bc58145b_XL.jpg


              Подробнее: http://nanoworld.org.ru/topic/648/page/2/



              Денис: Оперативно. Я так понял, что шарики в режиме БТГ не запустились. Повторять эксперимент будете?



              Принцип движения НЛО (Денис)

              Денис пишет: Оперативно. Я так понял, что шарики в режиме БТГ не запустились. Повторять эксперимент будете?

              Кушелев:

              "Оперативно" - не то слово. Вы на дату посмотрите: http://nanoworld.org.ru/topic/648/


              http://img-fotki.yandex.ru/get/9067/158289418.af/0_ae264_4777e0aa_orig.gif


              Готовлю:


              https://img-fotki.yandex.ru/get/118251/158289418.35b/0_162dce_f91908e7_XL.jpg


              Подробнее: http://nanoworld.org.ru/topic/1128/page/50/


              https://img-fotki.yandex.ru/get/113961/158289418.35c/0_163269_34cf81e9_XL.jpg


              Подробнее: http://nanoworld.org.ru/topic/716/page/99/




              ПРЯМЫЕ ТРАНСЛЯЦИИ ЭКСПЕРИМЕНТОВ ЛАБОРАТОРИИ НАНОМИР В ОНЛАЙНЕ И В ЗАПИСИ

              YUOTUBE  ГЛОБАЛЬНАЯ ВОЛНА


              22 октября 2016

              23 октября 2016

              24 октября 2016

              25 октября 2016

              26 октября 2016 часть 1

              26 октября 2016 часть 2

              27 октября 2016

              28 октября 2016

              30 октября 2016

              31 октября 2016

              01 ноября 2016                       2:16:00-6:29:00

              02 ноября 2016 часть 1

              02 ноября 2016 часть 2        0:43:57-2:35:39

              03 ноября 2016

              04 ноября 2016 часть 1        1:11:00-1:50:30

              04 ноября 2016 часть 2        0:29:00-3:16:25

              05 ноября 2016

              06 ноября 2016

              07 ноября 2016

              08 ноября 2016

              9 ноября 2016

              10 ноября 2016

              11 ноября 2016

              Отредактированный вариант 2016.11.11   Фрактальные эталоны из Лаборатории Наномир

              12 ноября 2016

              13 ноября 2016

              14 ноября 2016

              Точки над 'i'

              15 ноября 2016

              16 ноября 2016

              16-17 ноября 2016

              17 ноября 2016

              17-18 ноября 2016

              18 ноября 2016

              18-19 ноября 2016

              19 ноября 2016

              20 ноября 2016

              21 ноября 2016

              22 ноября 2016

              23 ноября 2016 часть 1

              23 ноября 2016 часть 2

              24 ноября 2016 года

              25 ноября 2016 года

              26 ноября 2016 года

              01 декабря 2016 года

              02 декабря 2016 года

              09 декабря 2016 года        Что станет с экономикой, если наука и общество признают эфир?

              10 декабря 2016 года        Нужен доступ на ускоритель в Дубне для включения рубинового источника энергии



              Фотографии экспериментов 2 декабря  

              Свечение резонатора 

               

              https://img-fotki.yandex.ru/get/196486/158289418.39e/0_16a7c2_2f2ec409_XL.jpg  

              Взрыв воды (почему пары подсвечены?) 

               

              https://img-fotki.yandex.ru/get/194549/158289418.39e/0_16a7c6_320bc4b9_XL.jpg

              Горение медого зеркала 

               

              https://img-fotki.yandex.ru/get/6113/158289418.39e/0_16a8c0_44ecdcd1_XL.jpg


              Видео записи экспериментов на двух камерах GoPro и Nikon за весь период



              Эксперимент 14 октября 2016  http://nanoworld.org.ru/post/77455/#p77455


              Составной рубиновый резонатор, настроенный на частоту микроволновки, позволяет наблюдать режимы, близкие к запуску рубинового генератора.


              В прямом эфире делаются эксперименты по извлечению энергии радиоэфира Фарадея-Максвелла(РЭФМ). Моделирование в программе HFSS показывает зоны, в которых конфигурация электромагнитных полей в диэлектрическом резонаторе вызывает вобблинг кольцегранных элементов РЭФМ.  (Кушелев: Программа показывает распределение динамических деформаций эфира, т.е. электрических и магнитных полей, как функций времени).  В данном случае мы подбираем колебательную моду, которая включит свечение резонатора от импульса магнетрона микроволновки 1 кВт 2,45 ГГц.  (Кушелев: Ищем колебательную моду, на которой возможно свечение. В этом случае напряженность поля достигнет 10 миллионов вольт на метр. Правильная суперпозиция таких полей и низкие потери резонаторов - условия трансформации внутренней энергии эфира в колебательную форму ("дребезг шестеренок Максвелла"-процесс преобразования энергии вращения в энергию колебаний). Проверяем резонаторы различной формы, частота которых совпадает с частотой магнетрона микроволновки. Запланирован эксперимент для другого магнетрона мощностью 10кВт в диапазоне 5 мм- 8 мм.

              Также ждёт включения на ускорителе в Дубне (сегодня ускоритель закрыт) резонатор из четырёх рубиновых шариков, один из которых засветился в 2011 году. Конфигурация из четырёх шариков по расчётам включит генерацию в режиме автоколебаний...


              Резонанс я использую, но только для того, чтобы создать сильные поля с малыми потерями энергии. А принцип добычи внутренней энергии эфира Фарадея-Максвелла называется "дребезг шестеренок Максвелла". Его можно создать с помощью резонаторов, но можно и иначе, например, с помощью антирезонансных усилителей стиля барокко, о чём можно прочесть в энциклопедии Наномир.  http://www.nanoworld.org.ru/data/05/20021102/index.htm



              А.Ю.Кушелев 

              Резюме 22 - 28 октярбя

              Формы, механизмы, энергия наномира. Сообщение 81 415

              Новости рубиновой / микроволновой энергетики и транспорта

              Daren пишет:

              Если есть резонанс то он есть и значит есть свечение постоянное и очевидное.

              Кушелев: Мне приходилось наблюдать как минимум 4 разных режима при резонансе.

              1. Образование дуги.
              2. Поверхностный пробой
              3. Пробой между проводником и диэлектриком, в котором электрический вектор перпендикулярен поверхности диэлектрика.
              4. Свечение без пробоя.

              В нашем случае свечение без пробоя было получено 23 октября. Это значит, что данная колебательная мода может быть нашей, если дополнительно создаются условия преобразования энергии.

              Но 28 октября мы наблюдали пробой между рубином и медным зеркалом (диэлектриком и проводником). Это связано с наличием воздушных зазоров. Чтобы их исключить с минимальными затратами денег и времени,  нужно изготовить рубиновый блок примерно 41*30*10 мм (в двух-трёх экземплярах).

              Китайцы отказываются делать блоки с размером больше 40*17*17 мм. Так что придётся покупать рубиновую булю диаметром не менее 33 мм и делать самим.

              Если удастся получить устойчивое, повторяемое свечение рубина на этой колебательной моде, то дальше пойдёт разговор об условиях преобразования энергии, добротности и т.д.




              http://nanoworld.org.ru/topic/1477/page/25/

              Формы, механизмы, энергия наномира. Сообщение 81 244

              2016-10-23:

              Видеосюжет 011

              https://img-fotki.yandex.ru/get/195561/158289418.371/0_166371_f7edde7c_XL.jpg https://img-fotki.yandex.ru/get/62989/158289418.371/0_166372_b80c4466_XL.jpg
              Кадр, на котором виден пробой                                   Кадр после окончания пробоя



              Формы, механизмы, энергия наномира. Сообщение 81 247

              2016-10-23:

              Видеосюжет 018  Отметка таймера: 1 минута 21 секунда.

              https://img-fotki.yandex.ru/get/172684/158289418.371/0_166398_5b1303e1_XL.jpg https://img-fotki.yandex.ru/get/196081/158289418.371/0_166399_f944e48c_XL.jpg
              Поверхностный разряд                                                    Кадр после разряда





              Видеосюжет 018: https://youtu.be/pBi_T809UEc

              Кадр 12 324  Свечение рубина без звука разряда максимально яркое

              https://img-fotki.yandex.ru/get/41468/158289418.372/0_166453_9a8cfa1f_XL.jpg

              Кадр 12 325   Обратите внимание на каплю воды, которая вылетает в процессе взрыва

              Она показана голубыми стрелками. На видео в это время слышен звук взрыва.

              https://img-fotki.yandex.ru/get/149179/158289418.372/0_166454_c15f7764_XL.jpg
              [20:46:45] Кушелев Александр Юрьевич: На видео чётко видно свечение рубина за кадр до взрыва




              http://nanoworld.org.ru/topic/1477/page/68/ 

              Эксперимент 3 ноября 2016 года показал наличие двух мод колебаний,

              смоделированных в программе HFSS 

              http://nanoworld.org.ru/post/78332/#p78332 




              https://img-fotki.yandex.ru/get/173114/158289418.387/0_167eb9_dfa167ec_XL.gif     https://img-fotki.yandex.ru/get/30530/158289418.387/0_167ebb_1dfe0965_XL.gif


              https://img-fotki.yandex.ru/get/51322/158289418.387/0_167ebd_43800d4c_XL.gif      https://img-fotki.yandex.ru/get/141254/158289418.387/0_167ebe_9e044551_XL.gif





              https://img-fotki.yandex.ru/get/196237/158289418.389/0_167fe3_84c784d6_XL.jpg

              https://img-fotki.yandex.ru/get/195561/158289418.389/0_167fe4_5a4cd74d_XL.jpg

              https://img-fotki.yandex.ru/get/102077/158289418.389/0_167fe5_a32164dc_XL.jpg

              https://img-fotki.yandex.ru/get/195561/158289418.389/0_167fe6_ea33c21e_XL.jpg

              https://img-fotki.yandex.ru/get/196722/158289418.389/0_167fe7_148f4a4c_XL.jpg

              https://img-fotki.yandex.ru/get/196081/158289418.389/0_167fe8_aa657152_XL.jpg

              https://img-fotki.yandex.ru/get/196237/158289418.389/0_167fe9_226c76a2_XL.jpg

              https://img-fotki.yandex.ru/get/170815/158289418.389/0_167fea_bb6b27aa_XL.jpg

              https://img-fotki.yandex.ru/get/118982/158289418.389/0_167feb_726931ee_XL.jpg

              https://img-fotki.yandex.ru/get/196081/158289418.389/0_167fec_7f6c44b8_XL.jpg

              https://img-fotki.yandex.ru/get/196237/158289418.389/0_167fed_7ed5be34_XL.jpg

              https://img-fotki.yandex.ru/get/195561/158289418.389/0_167ff1_20b50a3e_XL.jpg

              https://img-fotki.yandex.ru/get/196237/158289418.389/0_167fee_39be8b9d_XL.jpg

              https://img-fotki.yandex.ru/get/118982/158289418.389/0_167fef_146212b6_XL.jpg

              https://img-fotki.yandex.ru/get/196010/158289418.389/0_167ff0_455720c1_XL.jpg

              https://img-fotki.yandex.ru/get/170815/158289418.389/0_167ff2_6a6b1877_XL.jpg

              https://img-fotki.yandex.ru/get/196237/158289418.389/0_167ff3_cff0b8be_XL.jpg




              Формы, механизмы, энергия наномира. Сообщение 81 741

              Новости рубиновой / микроволновой энергетики и транспорта

              https://img-fotki.yandex.ru/get/174352/158289418.393/0_168342_33d2b77a_XL.jpg
              Резонансный пик на частоте 2.4375 ГГц

              https://img-fotki.yandex.ru/get/196020/158289418.393/0_168345_6fd4688f_XL.jpg

              https://img-fotki.yandex.ru/get/169451/158289418.392/0_1682fe_f20f4510_XL.jpg
              Кадр 3624 с видео: https://cloud.mail.ru/public/CC4A/uUPYMECmx

              https://img-fotki.yandex.ru/get/101645/158289418.392/0_168301_93abc96b_XL.jpg
              Кадр 3627  с видео: https://cloud.mail.ru/public/CC4A/uUPYMECmx

              https://img-fotki.yandex.ru/get/101645/158289418.392/0_168310_8733814e_XL.jpg
              Кадр 3642 с видео: https://cloud.mail.ru/public/CC4A/uUPYMECmx

              https://img-fotki.yandex.ru/get/196221/158289418.392/0_168311_bf260a50_XL.jpg
              Кадр 3643 с видео: https://cloud.mail.ru/public/CC4A/uUPYMECmx



              DSProLab:

              Для атласа мод шепчущей галереи сферического резонатора из корунда радиусом 4.81мм посчитано 500 мод, которые позволяют провести корректные оценки для поиска рабочих параметров. Вот ссылка на остальные 135 мод в порядке возрастания их частоты, начиная с 42 ГГц.
              По поводу текущих опытов, попытался  провести пробное моделирование в ЦСТ трапеции из корунда 34х34х40 в зеркалах, для которой найдена частота, при которой работает только сам резонатор. На анимации показана фазовая динамика магнитного потока на частоте 2,48926 ГГц:
              https://img-fotki.yandex.ru/get/110545/210357731.0/0_14b23b_58be1bf8_orig.gif.


              На остальных модах уже трещат зеркала и сам объём, что очень нежелательно.




              Формы, механизмы, энергия наномира. Сообщение 82 236

              Новости рубиновой / микроволновой энергетики и транспорта

              Kushelev пишет:

              [10:20:25] Кушелев Александр Юрьевич: На одном оборонном предприятии возбудили рубиновый шарик, но пока до уровня искрения: http://nanoworld.org.ru/topic/1128/page/51/

              Подробнее: http://nanoworld.org.ru/post/76547/#p76547

              Телефонограмма 2016-11-22

              О: Здравствуйте, Александр Юрьевич!
              Кушелев: Здравствуйте.
              О: Благодарим Вас за рубиновые шарики, которые Вы нам прислали.
              Кушелев: Могу ещё прислать, если сможете оплатить работу.
              О: Один шарик без отверстия нам удалось заставить светиться. Шарики с отверстиями не светятся. Только поверхностный пробой.
              Кушелев: Любопытно... Но можно сделать оправу для шариков без отверстий:


              http://www.nanoworld.org.ru/data/05/20021029/002.jpg


              Подробнее: http://www.nanoworld.org.ru/data/05/20021029/index.htm

              Я сейчас готовлю эксперимент в диапазоне 5 мм.


              http://www.nanoworld.org.ru/data/05/20021106/003.jpg

              http://www.nanoworld.org.ru/data/05/20021106/002.jpg


              Сапфировые вставки на диапазон 5 мм

              О: Вы можете изготовить 6 рубиновых шариков такого же диаметра без отверстий?

              Кушелев: Могу. Заготовки будут стоить по 40 USD, а моя работа - по 200 USD. Если у Вас получится включить группу из 3...5 шариков, то это будет означать, что рубиновая энергетика создана. Кстати, Вы можете прислать видеозаписи Ваших экспериментов?

              О: У нас оборонное предприятие, поэтому с видеозаписями проблема. Все параметры мы зафиксировали. Частоту, мощность, скважность, поляризацию, при которых светился один шарик.

              Кушелев: А Вы можете сказать мне эти параметры?

              О: Диаметр шарика 9.36 мм. Частота 35.00 ГГц. Скважность 100. Поляризация такая, что электрический вектор направлен радиально, т.е. по нормали к поверхности рубинового шарика.

              Кушелев: А яркость и цвет свечения?

              О: Цвет рубиновый, а яркость как 100-ваттная лампочка. Это если точно в резонанс попали. Если нет, то слабее.

              Кушелев: Свечение получается стабильное?

              О: Мы повторяли режим 15 раз. 12 раз было только искрение, а 3 раза наблюдалось свечение.

              Кушелев: Там очень много зависит от положения подводящего волновода. Если он шунтирует азимутальную колебательную моду, то может получиться свечение. Если не шунтирует, то будет искрение. В измерительном эксперименте можно добиться раздвоение спектрального пика изменением положения волновода. Это означает, что можно подавлять одну из колебательных мод, т.е. шунтировать, а другая при этом продолжает возбуждаться. Нужно шунтировать азимутальную моду, тогда радиальная возбуждается до уровня свечения.

              О: Понятно. Тогда нужно будет подавить паразитные моды во всех шариках группы, размещённых в оправе.

              Кушелев: Конечно. Это можно будет сделать на этапе измерений. Я попробую сделать оправу. Когда Вы сможете перевести деньги на заготовки и изготовление элементов резонатора из них?

              О: С деньгами у нас напряженка, т.к. этот эксперимент я провожу по личной инициативе. Руководство не в курсе. Поэтому я и не афиширую своё предприятие. Как появятся деньги, я Вам позвоню.

              Кушелев: ОК.

              О: Работа очень перспективная, нужно продолжать. Надеюсь, что Вас поддержат телезрители Глобальной Волны. Удачи и до связи.

              Кушелев: Всего доброго, жду звонка.

              Конец связи.




              Совет инвесторов лаборатории Наномир

              Телефонограмма N2

              Kushelev пишет:

              Формы, механизмы, энергия наномира. Сообщение 80 236

              Совет инвесторов лаборатории Наномир

              Новости рубиновой / микроволновой энергетики и транспорта

              2016-09-09

              Телефонограмма: Александр Юрьевич?
              -Да.
              -Здравствуйте! Помните, Вы в прошлом году присылали нам для эксперимента рубиновый шарик диаметром 9.36 мм?
              -Что-то припоминаю...
              -Нам удалось добиться искрения на частоте 35 ГГц.
              -Ровно 35 ГГц или с "копейками"?
              -Ровно. 35.00 ГГц.
              -Интересно. Надо будет разобраться, что за колебательная мода у Вас возбуждается.
              -Вы не могли бы к нам подъехать и помочь добиться режима свечения?
              -А Вы в каком городе?
              -...
              -Нет, это нереально.
              -Мы оплатим дорогу.
              -Если бы Ваш город стоял на берегу Черного моря... ха-ха
              -Он в другую сторону.
              -Не, мне туда не надо. Вы сами приезжайте в Дмитров.
              -У нас установка занимает десятки квадратных метров.
              -Присылайте фото, видео эксперимента. Будем на форуме разбираться.
              -У нас режимное предприятие.
              -В секретных работах я не участвую. Извиняйте. Задавайте вопросы на форуме, буду отвечать по мере возможности. Может быть ещё кто-то подключится к обсуждению.
              -Хорошо. Мой ник на форуме будет ...
              -ОК.
              -Вы, вероятно, наш разговор выложите на форум?
              -Уже.
              -Ладно, если не хотите конфиденциально, давайте на форуме. Но фото/видео мы выложить не можем, т.к. у нас их просто нет.
              -Тогда сложнее будет разобраться, что там у Вас происходит. Давайте для начала попробуем разобраться, какая колебательная мода возбуждается. Вы в программе HFSS или CST работаете?
              -Да. И в той, и в другой.
              -Попробуйте смоделировать моду, которая у Вас возбуждалась. На форуме обсудим.
              -ОК. Зарегистрируйте меня, если не трудно. Ник: ..., пароль, ...
              -ОК. До связи.
              -До связи.

              -Здравствуйте. Я по поводу искрения рубинового шарика на частоте 35 ГГц...
              Кушелев: -Добрый день! Я зарегистрировал Вас на форуме. Ник 35GHz, пароль *****
              -Спасибо, но мне удобнее Вам звонить. На форуме будет очень долго. Вы писали там, что для изготовления модулятора нужен конденсатор 0.5мкф 20кВ. Это на порядок меньше, чем в нашей установке. Искрение мы получаем стабильно, но свечения получить пока не удалось. Моделирование в CST показало, что на частоте 35 ГГц возбуждается четвертая азимутальная колебательная мода. На ней, как я понял, свечение невозможно.
              Кушелев: -Да. Нужно возбудить радиальную колебательную моду. Вы можете смоделировать радиальные колебательные моды в окрестностях этой частоты для Вашего шарика?
              -Попробуем. Я планирую на следующей неделе быть в Москве. Мы могли бы встретиться?
              Кушелев: -Созвонитесь с Ярославом Старухиным. Он организует встречи. Его телефон 8-926-2109383
              -Ближе к поездке. До встречи.
              Кушелев: До встречи.




              Новости рубиновой / микроволновой энергетики и транспорта

              Skype:

              [12.09.2016  10:19:53] Кушелев Александр Юрьевич: Привет!
              [10:20:25] Кушелев Александр Юрьевич: На одном оборонном предприятии возбудили рубиновый шарик, но пока до уровня искрения: http://nanoworld.org.ru/topic/1128/page/51/
              [10:21:28] Кушелев Александр Юрьевич: Они по телефону сказали мне, что у них модулятор очень простой, без стабилизатора, но ёмкость кондерсатора 10 микрофарад на 25 киловольт.
              [10:21:50] Кушелев Александр Юрьевич: Это значит, что такой модулятор стоит не больше магнетрона
              [10:22:48] Кушелев Александр Юрьевич: У них там два ключа. Один быстро открывает, а другой быстро закрывает ток из конденсатора в магнетрон. Самое дорогое там - электронная защита, если закрывающий ключ пробъёт.
              [10:23:38] Кушелев Александр Юрьевич: При такой ёмкости конденсатора ток через магнетрон не меняется больше, чем на 0.01%, поэтому получается когерентный импульс.
              [10:24:33] Кушелев Александр Юрьевич: А если есть искрение резонатора, то тот же магнетрон сможет и засветить шарик.
              [10:25:43] Перспективный инвестор : А как попасть на этот завод к этому магнетрону?
              [10:28:24] Кушелев Александр Юрьевич: Я пока не знаю, в каком они городе. То ли Новосибирск, то ли Обнинск. Они говорили год назад, но я забыл. Надо будет ещё раз спросить.
              [10:29:12] Кушелев Александр Юрьевич: Золдракс достал конденсатор 0.5 микрофарады на 25 киловольт, но это в 20 раз меньше, чем надо.
              [10:29:43] Кушелев Александр Юрьевич: Это обеспечит примерно 0.2% спада напряжения, а нам нужно 0.01%
              [10:30:02] Кушелев Александр Юрьевич: А у оборонщиков 0.01% как раз
              [10:30:27] Кушелев Александр Юрьевич: Но у микроволновки когерентность ещё лучше
              [10:30:38] Кушелев Александр Юрьевич: Помнишь, у меня шарик засветился в микроволновке?
              [10:31:16] Кушелев Александр Юрьевич: Хотя там мощность всего 1 кВт, зато когерентность раз в 10 выше, чем у импульсного магнетрона МИ-88
              [10:43:28] Кушелев Александр Юрьевич: По расчёту импульсная мощность свечения рубинового шарика диаметром 1 см должна быть типа 1.5 кВт.
              [10:47:11] Кушелев Александр Юрьевич: Получается, что на холостом ходу рубиновый источник энергии из 4 таких шариков должен светить мощностью типа 6 кВт, а при отборе в нагрев он должен дать больше, но без эксперимента нельзя сказать. По расчёту 10 кВт, а в реальности может быть от 6 киловатт до 20. При 20 киловаттах рубиновый генератор точно выключится, т.к. в этом случае нагруженная добротность будет меньше 2000
              [10:47:56] Кушелев Александр Юрьевич: Скорее всего максимальная нагрузка будет около 10 кВт
              [10:51:49] Кушелев Александр Юрьевич: Шарики из рубина N5 будут работать при бОльшей напряжённости поля, чем шарики из рубина N7 и N8, т.е. будут давать в нагрузку больше мощность. Но при этом есть вероятность того, что без нагрузки они могут выйти из строя, т.к. у них меньше запас по напряжённости.
              [10:52:55] Кушелев Александр Юрьевич: Если шарики из рубина N5 будут выходить из строя, придётся заказывать рубиновые шарики, эллипсоиды, кирпичики ... только из рубина N7 или N8
              [10:53:46] Кушелев Александр Юрьевич: Кстати, в Дубне светился зеленый шарик с интенсивностью окраски типа N8
              [10:54:16] Кушелев Александр Юрьевич: Он вышел из строя при 100-кратной перегрузке.
              [10:59:24] Кушелев Александр Юрьевич: А в микроволновке сапфировый шарик первый раз светился на уровне 100 ваттной лампочки. Это означает, что вполне могло хватать мощности микроволновки и не факт, что выделялась энергия эфира. А в последний раз инвестор S говорил, что яркость была раз в 10 больше, чем при сварке. Это уже магнетроном не обеспечить...
              [11:00:17] Кушелев Александр Юрьевич: По моей оценке рубиновый источник энергии на частоту микроволновки 2.45 ГГц должен дать типа 800 киловатт.
              [11:01:33] Кушелев Александр Юрьевич: А это значит, что яркость свечения может быть такой, что фото/видео испортятся, если они не будут защищены солнечными светофильтрами. Так что нужно ещё светофильтры покупать, иначе угрохаем фото/видео.
              [11:02:38] Кушелев Александр Юрьевич: На холостом ходу свечение может быть больше 400 кВт.
              [11:04:26] Кушелев Александр Юрьевич: Печке, конечно, будет хана, но что поделаешь ... smile
              [11:08:22] Перспективный инвестор : Вопрос в том что бы это случилось, а это тоже не факт )
              [11:15:02] Кушелев Александр Юрьевич: Заранее нельзя сказать, где быстрее включим, в печке или от импульсного магнетрона. Но где светился один шарик (и в печке, и от ускорителя), там можно включить группу шариков или параллелепипед с зеркалами.



              https://img-fotki.yandex.ru/get/60881/158289418.35c/0_1631d8_aba7573b_XL.jpg



              Продолжение http://nanoworld.org.ru/topic/1128/page/52/ 




              Skype, 2016-11-23:

              [23:07:43] Vorontsov: Вот вычитал про рубиновое яйцо в книге Носовского и Фоменко "Империя" "Известно, что до вторжения Наполеона в Египет в 1798 году эта страна была в значительной мере ЗАКРЫТА ДЛЯ ПОСЕЩЕНИЯ ЕВРОПЕЙЦЕВ.
                   О Египте якобы IX-XIV веков имеется несколько разрозненных сообщений арабов, которые, впрочем, считаются сегодня в основном ФАНТАСТИЧЕСКИМИ ([56], с. 39-43). Например, в пирамиде был якобы найден "БАССЕЙН, наполненный ЧЕКАННЫМИ ЗОЛОТЫМИ МОНЕТАМИ... Бассейн этот, говорят, был сделан ИЗ ИЗУМРУДА" ([56], с. 39).
                   Кайзи - автор якобы XII века - рассказывал, что в пирамиде обнаружили "тело человека, облаченного в ЗОЛОТУЮ КИРАСУ, инкрустированную всевозможными камнями; на груди его лежал меч, которому не было цены, а в изголовье - КРАСНЫЙ РУБИН величиною с КУРИНОЕ ЯЙЦО, горевший как огонь" ([56], с. 40). "




              Новости рубиновой / микроволновой энергетики и транспорта

              Кушелев: Письмо инвесторам:
              Здравствуйте!
              Эксперименты в микроволновке помогли найти нужную колебательную моду и определить размеры и формы рубинового резонатора. Составной резонатор имеет нужную частоту и добротность, но при возбуждении до миллиона вольт на метр начинается пробой между блоками. Чтобы его исключить и добиться свечения и перехода в режим генерации нужно изготовить резонатор из одного куска рубина. В настоящее время собрано 170 USD. 1 кг рубина, выращенного по методу Чохральского стоит 280 USD. Если можете поучаствовать в приобретении рубина, было бы очень здОрово smile




              Формы, механизмы, энергия наномира. Сообщение 82 384

              Новости рубиновой / микроволновой энергетики и транспорта

              Кушелев: Письмо руководству космической фирмы.

              Здравствуйте, уважаемые коллеги!

              Если Вы не в курсе, то электромагнитный двигатель без реактивной струи (Microwave Engine, Emdrive) был испытан в России, в лаборатории Наномир в 1992-ом году. Статья об испытаниях была опубликована в международном научном журнале: http://dx.doi.org/10.1108/00022660010340178

              В NASA аналогичный Emdrive испытали на 22 года позже, т.е. в 2014-ом году, но уже в 2017-ом планируют испытания на околоземной орбите.

              "Наука не стоит на месте". Пока Роджер Шаер предлагает испытать новую модель Emdrive из сверхпроводника (я это предлагал в 1993-ем году), в лаборатории Наномир изготовлен рубиновый двигатель (Ruby Emdrive), который при массе 0.5 грамма сможет поднять в 1000 раз больше, т.е. 0.5 кг. Объём двигателя, включая источник питания с расчётной мощностью 3 кВт занимает объём 0.5 кубического сантиметра.

              Предлагаю Вам измерить параметры рубинового двигателя, в т.ч. реальную мощность и силу тяги на Вашем опытном производстве. Для этих испытаний нужен стартовый генератор, например, импульсный магнетрон на частоту 53.51 ГГц. Подойдёт и любой другой импульсный магнетрон в диапазоне от 3 до 10 мм, но в этом случае нужно будет включить номинальный ряд рубиновых генераторов, от которого уже будет включен рубиновый двигатель.


              http://img-fotki.yandex.ru/get/6707/158289418.11a/0_e3127_6e23d790_XL.jpg


              Измеренные параметры рубинового двигателя


              http://img-fotki.yandex.ru/get/5819/158289418.19d/0_fec91_d028a2c3_XL.gif


              Двигатель на стенде холодных измерений




              Изготовлена часть номинального ряда рубиновых генераторов

              Если Вас интересует данная тема, готов рассмотреть проект договора.

              Руководитель лаборатории Наномир,
              Александр Кушелев
              8-926-5101703
              8-903-2003424
              8-916-8265031
              Skype: kushelev2009




              Создаём международный исследовательский центр Александра Кушелева

              В этом центре каждый желающий может определить параметры любого устройства.
              Убедиться, что сегодня на нашей планете ещё нет ни одного БТГ / СЕ.

              Но есть Emdrive (Microwave Engine)
              Александра Кушелева,
              Роджера Шаера,
              Гвидо Фетта.

              На самом деле у Роджера Шаера уже 3 модели Emdrive. Последняя - сверхпроводящая.

              А у меня - эволюционный ряд:


              http://nanoworld88.narod.ru/data/410_files/foto_070.jpg


              Подробнее: http://nanoworld88.narod.ru/data/410.htm

              Emdrive любой модели отталкивается от эфира Фарадея-Максвелла и прямым экспериментом доказывает его существование, возвращая незаконно повергнутую классическую физику Ньютона и Максвелла на пьедестал.

              Ошибки физиков-создателей квантовой "механики" и "теории" относительности философские.

              Квантовые "механики" обобщили ошибочность конкретной модели атома на всю классическую физику, т.е. допустили грубейшую философскую ошибку. Замена планетарной модели атома на кольцегранную, которая, наконец, подтвердилась прямым экспериментом в 2014-ом году, возвращает микромир в лоно классической механики Ньютона и Гюйгенса.


              http://nanoworld88.narod.ru/data/493_files/0_13756e.jpg


              Подробнее: http://nanoworld88.narod.ru/data/493.htm

              Ошибка Эйнштейна - обобщение принципа относительности Галилея на скорости, сравнимые со скоростью света. Как только становится заметна звёздная аберрация, принцип относительности Галилея уже не работает.

              Лоренцевы сокращения есть и в акустике, как показал Ю.Н.Иванов (Ритмодинамика) в 1982-ом году. Но переход от сокращений к преобразованиям координат - грубая философская ошибка. Судите сами. Скорость света по таблицам Кассини можно определить по формулам Галилея, а в формулы Лоренца скорость света можно только переставить из ответа, полученного по формулам Галилея. Это значит, что самостоятельного смысла формулы преобразований координат Лоренца не имеют.





              Обсуждение проведённых экспериментов на Форуме Лаборатории Наномир

              http://nanoworld.org.ru 




              Новости рубиновой / микроволновой энергетики и транспорта

              http://nanoworld.org.ru/topic/1128/ 




              Совет инвесторов Лаборатории Наномир

              http://nanoworld.org.ru/topic/716/





              Канал А.Ю. Кушелева на YouTube

              Трансляции, эксперименты. Научные направления Лаборатории Наномир

              https://www.youtube.com/channel/UCsx422KjIzwTWTBPPpwBlXQ 





              Инвестирование, лицензии, менеджемент, продвижение, представительство

              Работа с менеджером по нескольким научным направлениям     1   2   3   4   5   6   7
















              Конкурс CASP December 2017

              http://nanoworld.org.ru/topic/1150/page/3/   2016.10.12 22:26:13  

              Формы, механизмы, энергия наномира. Сообщение 80 867

              Victoriy пишет:

              Приглашение на очередную 12-ю CASP конференцию (на этот раз в Италии) December 10-13th 2016, Gaeta (Italy)
              Правда регистрационный взнос в 1000 евро и это без дороги -- кусается smile.

              CASP: Early bird registration deadline for the CASP12 meeting is October 10th
              A reminder that the deadline for early bird registration for the CASP12 meeting in Gaeta is now very close - next Monday October 10th.

              The second planning meeting, in which the assessors present their preliminary findings to the organizers, was held a couple of weeks ago, and there is some pretty exciting stuff. In particular, looks like substantial improvement in average "new fold" model accuracy, probably due to the new co-evolution methods. The new "is the model as good as experiment for understanding function" category has a team of four assessors, led by Russ Altman, and should produce substantial insights. Very intriguing comparisons between SAXS data, experimental structures, and models. Again we have a collaboration with CAPRI for modeling assemblies, with a more substantial body of data than previously. And, of course, many interesting results in comparative modeling, refinement, and accuracy estimation.

              Registration: http://www.cevs.ucdavis.edu/confreg/ind … webid=4026

              Specifics of the travel arrangements:
              http://predictioncenter.org/casp12/meet … ctions.cgi

              Additional information:

              12th CASP Meeting
              December 10-13th 2016, Gaeta (Italy)

              The meeting concludes the 12th international CASP (Critical Assessment of Techniques for Protein Structure Prediction) experiment. The goal of the meeting is to discuss the state of the art of methods for predicting protein structure, assembly, and function from sequence, reporting and discussing the results of a blind assessment.


              Confirmed invited speakers:
              Russ Altman - Stanford University - USA
              Alexandre Bonvin - Utrecht University - NL
              Guido Capitani - Paul Scherrer Institut - CH
              Matteo Dal Peraro - Ecole Polytechnique Federale de Lausanne - CH
              Edward H. Egelman - University of Virginia - USA
              Francesco Gervasio - UCL - UK
              Michael Levitt - Stanford University - USA

              Location

              The meeting will be held at Hotel Serapo (www. http://www.hotelserapo.com/en/), on the slopes of the Natural Park of Monte Orlando in a beautiful and panoramic corner overlooking Serapo Beach, very close to the city center and the old town of Gaeta.

              The city itself, the so-called Ulysses Riviera, is embedded in a fascinating area, full of surprises, natural beauties, history, art and culture. It is conveniently located between Rome and Naples. It overlooks the Tyrrhenian Sea. Its history as a resort dates back to Imperial Rome. Nearby sites include the first-century BC mausoleum of general Lucius Munatius Plancus. Its old town is mostly medieval, showcased by narrow alleys, the massive 13th-century castle and the 12th-century Cathedral of Assunta e Sant"Erasmo.


              Registration details:
              Deadline for early bird registration: October 10th, 2016
              Deadline for late registration: November 14th, 2016

              Registration fees (***):
              Separate room Shared room
              Early bird registration US$ 975 / ~850 Euro US$ 870 / ~750 Euro
              Late registration US$ 1,125 / ~1000 Euro US$ 1,020 / ~900 Euro
              Accompanying person (*) US$ 340 / ~300 Euro
              Extra day before or after the meeting (**): US$ 90 / ~80 Euro per person

              (*) Includes accommodation and full board for the period of the conference and Gala Dinner.
              (**) Includes accommodation and full board.
              (***) Depending on the resources available, some students might be entitled to receive a partial refund of the registration fee. Eligible registered applicants will be contacted after the early registration deadline. The amount of reimbursement will depend upon available financial resources.


              Кушелев: Я бы очень хотел, чтобы Виктория Соколик, богиня пикотехнологии (а теперь ещё и богиня вечной молодости!) сделала доклад на конференции CASP. Ведь после создания пикотехнологии нанотехнология безвозвратно устарела. Это значит, что все, кто сегодня вкладывают в устаревшую нанотехнологию, выбрасывают деньги на ветер, а могли бы вложить в современную пикотехнологию и поднять нашу цивилизацию на новую ступень развития.


              https://img-fotki.yandex.ru/get/58675/158289418.356/0_1613ab_1d664fd2_XL.jpg


              Структура белка 1VOL. Совмещение с ДНК в Пикософте и PDB

              Вводная часть 1 , 2 

              Начало работы. Пикотехнологические модели двух частей комплекса 1VOL

              https://nano-world-articles.nethouse.ru/articles/326755 


              Кушелев: В комплексе 1VOL не две одноцепочечные РНК, а двойная спираль из 16 ступеней:

              http://www.rcsb.org/pdb/pv/pv.do?pdbid= … ionumber=1

              https://img-fotki.yandex.ru/get/143188/158289418.3a4/0_16d2b6_acc24aaa_XL.jpg



              https://img-fotki.yandex.ru/get/196534/158289418.3a4/0_16d2d1_5547f72d_XL.png
              Так выглядят две субъединицы ДНК из комплекса 1VOL

              Можно более или менее красиво изобразить пикотехнологическую модель ДНК изолированными атомами.

              https://img-fotki.yandex.ru/get/198303/158289418.3a4/0_16d2d5_72f71711_XL.png
              Так в программе Hyperchem изображаются атомы азотистого основания гуанина. В принципе сносно.

              Осталось добавить координаты атомов рибозы и фосфатной группы. А дальше дублировать нуклеотид, поворачивать и смещать на вектор, который можно взять из скрипта-конструктора ДНК.


              Формы, механизмы, энергия наномира. Сообщение 83 020

              http://nanoworld88.narod.ru/data/237_files/0_4dfa5_6905ee99_L.png

              Удалось вписать в PDB файл координаты атомов азотистого основания (гуанина) и рибозы.

              https://img-fotki.yandex.ru/get/196548/158289418.3a4/0_16d2d6_5e30d730_XL.png
              Программа Hyperchem показывает атомы углерода светло-голубыми кружочками, атомы азота - синими, а атомы кислорода - красными. Верхний атом кислорода находится ближе к нам, чем плоскость азотистого основания, а два других - дальше. Все остальные атомы лежат в плоскости азотистого основания.                                        

              Осталось добавить атом фосфора и три атома кислорода, чтобы завершить модель нуклеотида.
              После этого можно будет его дублировать, поворачивать и смещать на вектор, который можно позаимствовать из скрипта "Конструктор ДНК/РНК"

              Координаты атомов для файла PDB были взяты по этой разметке:

              https://img-fotki.yandex.ru/get/176331/158289418.3a4/0_16d2d7_674cdb88_XL.jpg
              Оригинал: https://img-fotki.yandex.ru/get/176331/ … 8_orig.jpg


              Формы, механизмы, энергия наномира. Сообщение 83 022

              https://img-fotki.yandex.ru/get/42692/158289418.3a5/0_16d2d8_bcc25a22_XL.png 
              Координаты для PDB-файла определены.

              https://img-fotki.yandex.ru/get/114758/158289418.3a5/0_16d2d9_cd41f6c9_XL.png
              Модель нуклеотида (гуанинмонофосфата) готова.                       
                          

              Теперь осталось построить 16 звеньев одноцепочечной РНК, дублируя, поворачивая и сдвигая на известный вектор модель одного нуклеотида.

              Осталось найти программу, в которой удобно ввести PDB-файл с моделью нуклеотида, скопировать, сдвинуть и повернуть. Кстати, этот вектор нужно умножить на согласующий коэффициент, т.к. модель нуклеотида собрана в другом масштабе...

              В скрипте "ДНК-конструктор" радиус кольца-электрона задавался равным 4.8, а в PDB радиус равен 0.7. Соответственно вектор и точка привязки должны быть умножены на коэффициент 0.7/4.8=0,1458333

              В программе PyMol вроде можно было задать вращение и перемещение численно. А если не получится, то записать в виде скрипта для 3DS Max, построить модель ДНК и вывести в виде файла координат. После чего добавить координаты в PDB-файл.

              Кстати, классная плоская модель нуклеотида получится. Всего 23 вершины тонкой фигуры. Надо посмотреть, как будет выглядеть. Очень компактное графическое представление...


              https://img-fotki.yandex.ru/get/4208/158289418.3a5/0_16d2fb_b5dfb41_XL.pnghttps://img-fotki.yandex.ru/get/54522/158289418.3a5/0_16d2fc_ef7f19ee_XL.png

              Плоская модель нуклеотида, где вершинами являются выступающие ядра атомов, смотрится очень необычно...

              Анимация: https://cloud.mail.ru/public/JXhm/Qz6NrbsRq


              Построить на базе этой модели нуклеотида структуру одноцепочечной РНК - не проблема. Завтра мы с этого и начнём...

              Плоские модели нуклеотидов могут очень пригодиться для моделирования гигантских РНК типа рибосомальной. Это очень компактное представление, в котором все ядра атомов могут быть установлены идеально.


              Модель одноцепочечной РНК, состоящей из 16 нуклеотидов: https://cloud.mail.ru/public/69Aq/DxC1qoVho


              На этой модели заметно, что на один оборот спирали приходится не 10, а 6 оснований ДНК. При шаге спирали 34 ангстрема на каждую ступень приходится 34/6 =5.67 ангстрема. По общепринятой версии на каждую ступень приходится 34/10=3.4 ангстрема. Это связано с неправильной настройкой угла между нуклеотидами.

              http://nanoworld88.narod.ru/data/236_files/0_4e1a8_e8302c5f_M.gif
              Позднее в процессе настройки я получил параметры, которые соответствуют данным РСА, т.е. 10 нуклеотидов на виток ДНК.

              Так что углы поворота придётся подправить...


              Формы, механизмы, энергия наномира. Сообщение 83 027

              https://img-fotki.yandex.ru/get/197700/158289418.3a5/0_16d39e_b0e61ab7_XL.png


              анимация: https://cloud.mail.ru/public/2dCq/DYkHq7aJt


              Теперь оформим эти координаты в виде PDB-файла.


              Но лучше сделать PDB-файл сразу для двухцепочечной РНК. Ведь удалить одну цепочку легко.


              Анимация: https://cloud.mail.ru/public/3HLS/tEqiBm5wW


              https://img-fotki.yandex.ru/get/149179/158289418.3a5/0_16d433_eca89796_XL.png


              https://img-fotki.yandex.ru/get/171750/158289418.3a5/0_16d435_17477518_XL.png

              https://img-fotki.yandex.ru/get/171750/158289418.3a5/0_16d436_22715fdf_XL.png

              Понятно, что для 16 ступеней двухцепочечной ДНК PDB файл желательно сформировать с помощью скрипта для 3DS Max.


              Skype, 2016-12-17:

              [20:19:39] Кушелев Александр Юрьевич: Привет, Валентин!
              [20:19:54] Кушелев Александр Юрьевич: Может сохранить из скрипта PDB-файл?
              [20:19:56] Кушелев Александр Юрьевич: http://nanoworld.org.ru/post/80451/#p80451
              [20:20:26] Кушелев Александр Юрьевич: Есть образец для 1 из 32 кусков, сделанный вручную
              [20:22:20] Кушелев Александр Юрьевич: Правда, по образцу можно сделать 16 кусков PDB-файла, а другие 16 кусков на пару атомов меньше, поэтому я сделаю для них второй образец.
              [20:25:56] Кушелев Александр Юрьевич: Второй образец отличается тем, что там отсутствует 14-й и 16- атомы из первого образца.
              [20:28:25] Кушелев Александр Юрьевич: PDB-файл, который ты выведешь из скрипта, можно послать американскому заказчику, чтобы он вставил модель РНК в белковый комплекс. Если вставится, то это - победа пикотехнологии.
              [20:29:16] Кушелев Александр Юрьевич: А если мы сами присобачим модель РНК к моделям белков, то можно будет опубликовать научную статью и подать на нобелевскую smile


               ПИКОМЕХАНИКА тРНК

               МОДЕЛЬ ФРАГМЕНТА ЛИЗОЦИМА

               МОДЕЛЬ ГИСТОННОГО КОМПЛЕКСА

               КОМПОЗИЦИОННЫЙ КОД


              Skype, 2016-12-18:

              [15:26:25] Кушелев Александр Юрьевич: Образец PDB-файла для одной ступени РНК/ДНК: http://nanoworld.org.ru/post/80481/#p80481
              [15:27:46] Кушелев Александр Юрьевич: Нужно по этому шаблону сделать файл для 16 ступеней по этим координатам: http://nanoworld.org.ru/post/80451/#p80451
              [15:28:50] Кушелев Александр Юрьевич: Это можно было бы сделать вручую в программе типа "Волков командер", где можно стоблцами оперировать. Но у меня эта программа не установлена...
              [15:42:05] Va12220(valqwa): Саша, привет!
              попробую. сегодня до вечера
              [15:43:05] Кушелев Александр Юрьевич: Благодарю!
              [15:51:14] Кушелев Александр Юрьевич: Интересно сделать вывод файла именно из скрипта, чтобы в будущем выводить такие файлы для РНК/ДНК и комплексов "белок-РНК/ДНК"


              Victoriy

              А.Ю., ещё раз сделала модели нуклеотидов и модель двух комплементарных пар А=Т и G=С
              https://img-fotki.yandex.ru/get/102077/417565639.0/0_11b84a_45a92796_orig.jpg


              Кушелев: Класс! Благодарю!

              Что касается комплекса 1VOL, то там двухцепочечная ДНК, а я делаю модели РНК, т.к. из них ДНК получаются исключением OH групп.



              [0:19:33] Va12220(valqwa): все. спать? )

              https://img-fotki.yandex.ru/get/174613/158289418.3a5/0_16d601_4c2be31a_XL.png

              https://img-fotki.yandex.ru/get/196183/158289418.3a5/0_16d602_93747e0b_XL.png

              https://img-fotki.yandex.ru/get/174613/158289418.3a5/0_16d603_ed6fe55c_XL.png

              https://img-fotki.yandex.ru/get/194425/158289418.3a5/0_16d604_58b8c191_XL.png

              [0:19:57] Кушелев Александр Юрьевич: Класс!

              [0:20:29] Va12220(valqwa): долго ли умеючи, ну смотри. делай выводы и поправки. пиши мне их.
              [0:20:32] Кушелев Александр Юрьевич: А как ты оцениваешь сложность задачи показать все возможные точки роста молекулы белка?
              [0:20:55] Кушелев Александр Юрьевич: На первом шаге 3 точки, на втором 9 и т.д.
              [0:21:09] Va12220(valqwa): если ты дашь определение "точек роста молекулы белка" - то как обычную задачу
              [0:21:42] Кушелев Александр Юрьевич: Ну помнишь задачу, где треугольник перемещался по трём вариантам?
              [0:21:55] Кушелев Александр Юрьевич: Центр треугольника нужно изобразить точкой
              [0:22:04] Кушелев Александр Юрьевич: От неё три точки
              [0:22:09] Va12220(valqwa): скорее не помню. записи остались. по ним вспомню. когда найду )
              [0:22:13] Кушелев Александр Юрьевич: От каждой следующей опять три точки
              [0:22:48] Кушелев Александр Юрьевич: Вот алгоритм: .............

              [0:23:13] Кушелев Александр Юрьевич: Но здесь по композиционному коду строится конкретная модель белка
              [0:23:29] Кушелев Александр Юрьевич: Каждый аминокислотный остаток изображается многогранником
              [0:23:39] Кушелев Александр Юрьевич: Подробнее: http://nanoworld88.narod.ru/data/263.htm
              [0:23:43] Кушелев Александр Юрьевич: А нам нужно точкой
              [0:24:16] Кушелев Александр Юрьевич: И чтобы на каждом шаге было показано не одна точка, а три, т.е. показаны все варианты композиции
              [0:24:31] Кушелев Александр Юрьевич: На каждом шаге должно быть "дробление на три"
              [0:24:50] Кушелев Александр Юрьевич: Точки должны утраиваться на каждом шаге алгоритма
              [0:25:22] Кушелев Александр Юрьевич: Мы должны увидеть все варианты роста белка сразу
              [0:25:34] Кушелев Александр Юрьевич: На первом шаге 3 варианта в виде 3 точек
              [0:25:45] Va12220(valqwa): да можно все сделать. вот только уже не сейчас. сейчас - спать )


              Татьяна Рясина пишет:

              А чем вообще сегодня с учётом современных возможностей можно как следует до атома увидеть молекулы белков? Чтобы таки сопоставить 3D визуализацию по методу Пикотеха и данные экспериментов? Что вообще может прийти на смену РСА?

              Кушелев: Кольцевые грани атомов удалось увидеть с помощью АСМ в 2014-ом году: http://nanoworld88.narod.ru/data/493.htm

              Однако прощупывать молекулы белков таким способом очень трудоёмко. Я предполагаю, что раньше смогут определить формы некоторых молекул, например, азотистых оснований. Когда увидят, что атомы в азотистых основаниях расположены в шахматном порядке, ситуация снова резко изменится. Ведь во всех базах типа PDB сегодня формы молекул неправильные даже на уровне топологии, не говоря о форме.

              После подтверждения формы ступени ДНК с помощью АСМ пикотехнологию будут воспринимать серьёзно.


              [18.12.2016 22:00:47] Andrei: пришел ответ от доктора
              [18.12.2016 22:01:31] Andrei: у Соколик лучше результат
              [18.12.2016 22:01:37] Andrei: ближе к РСА
              [18.12.2016 22:03:33] Кушелев Александр Юрьевич: Она к этому и стремилась.
              [18.12.2016 22:04:04] Кушелев Александр Юрьевич: А можно посмотреть на этот ответ целиком?
              [18.12.2016 22:04:38] Andrei: I used the models of PDB files to align with the experimental structure in the PDB.
              For Kushelev model and 1volA the RMSD was 18 Angstrom (please see figure attached)

              https://img-fotki.yandex.ru/get/110545/158289418.3a5/0_16d5f2_261f4f43_XL.png
              For Sokolik TFIIB_204 model and 1volA the RMSD was 16.5 Angstrom
              Finally for the alignment of of TFIIB and TFIIB_204  the RMSD was 18 Angstrom.
              I used the Pymol software to calculate the alignments.
              I wonder whether there is explanation to those results or I miss something.
              In addition the sequence of TFIIB 1volA is attached in FASTA file just to make sure the the structural models are based on this specific sequence.
              [18.12.2016 22:08:42] Кушелев Александр Юрьевич: Нужна последовательность FASTA и рисунки, вложенные в письмо
              [18.12.2016 22:08:42] Andrei: еще есть файлы
              [18.12.2016 22:08:49] Кушелев Александр Юрьевич: Давайте их посмотрим
              [18.12.2016 22:09:13] Кушелев Александр Юрьевич: 18 анстрем - неплохо для РСА smile
              [18.12.2016 22:09:56] Andrei: так 2А пишут в базе
              [18.12.2016 22:10:07] Andrei: технология улучшилась
              [18.12.2016 22:10:14] Кушелев Александр Юрьевич: Там можно и 0.002А написать. Вы тоже поверите? smile
              [18.12.2016 22:10:45] Andrei: это официальная база, если обманут то это уголовное дело
              [18.12.2016 22:10:55] Andrei: никто с этим не будет связываться
              [18.12.2016 22:11:06] Andrei: там и репутация автора
              [18.12.2016 22:11:31] Andrei: это не совок что кто что хочет то и пишет так как ответственности нет
              [18.12.2016 22:11:55] Andrei: послал
              [18.12.2016 22:11:59] Кушелев Александр Юрьевич: Вы же видели, что в 2012-ом году "обман" уменьшился на 3% по сравнению с 2010-ым годом smile
              [18.12.2016 22:13:11] Кушелев Александр Юрьевич: Давайте лучше файлы посмотрим.
              [18.12.2016 22:13:17] Andrei: послал говорю
              [18.12.2016 22:13:26] Кушелев Александр Юрьевич: По почте?
              [18.12.2016 22:13:30] Andrei: да

              >1VOL:A PDBID CHAIN SEQUENCE
              AMMNAFKEITTMADRINLPRNKVDRTNNLFRQAYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEI
              CAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRS
              PISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL

              https://img-fotki.yandex.ru/get/113457/158289418.3a5/0_16d609_3d4263d7_S.gifhttps://img-fotki.yandex.ru/get/196237/158289418.3a5/0_16d60a_3625c753_S.pnghttps://img-fotki.yandex.ru/get/25921/158289418.3a6/0_16d60b_9c743780_S.gifhttps://img-fotki.yandex.ru/get/52656/158289418.3a5/0_16d60c_15c020fe_S.pnghttps://img-fotki.yandex.ru/get/170627/158289418.3a5/0_16d60d_315640ab_S.pnghttps://img-fotki.yandex.ru/get/113457/158289418.3a5/0_16d60e_8e13985e_S.pnghttps://img-fotki.yandex.ru/get/128227/158289418.3a5/0_16d60f_48fec44f_S.pnghttps://img-fotki.yandex.ru/get/170627/158289418.3a6/0_16d611_c9eb8bdd_S.gifhttps://img-fotki.yandex.ru/get/131711/158289418.3a5/0_16d612_dd6f0fc6_S.pnghttps://img-fotki.yandex.ru/get/194541/158289418.3a6/0_16d613_a53c7691_S.gifhttps://img-fotki.yandex.ru/get/102548/158289418.3a5/0_16d614_7464e284_S.pnghttps://img-fotki.yandex.ru/get/52656/158289418.3a6/0_16d615_19b5db72_S.pnghttps://img-fotki.yandex.ru/get/102077/158289418.3a6/0_16d616_617e6a39_S.pnghttps://img-fotki.yandex.ru/get/49312/158289418.3a6/0_16d617_260b955d_S.png

              [18.12.2016 22:14:15] Andrei: забыл тот ответ - так почему днк должно войти в белок?
              [18.12.2016 22:20:35] Кушелев Александр Юрьевич: Комплекс 1VOL - это две белковые молекулы, которые читают ДНК, поэтому структура белковых молекул должна быть согласована со структурой ДНК.
              [18.12.2016 22:21:08] Кушелев Александр Юрьевич: РСА показывает, что ДНК проходит внутри белковых молекул. Но деталей не показывает.
              [18.12.2016 22:21:35] Кушелев Александр Юрьевич: Если мы сделаем правильные пикотехнологические модели белков и ДНК, то увидим, как они сопрягаются на уровне пикометров.
              [18.12.2016 22:22:00] Кушелев Александр Юрьевич: А реальная точность моделей, построенных по данным РСА - десятки-сотни ангстрем.
              [18.12.2016 22:22:04] Andrei: когда это будет готово?
              [18.12.2016 22:22:55] Кушелев Александр Юрьевич: Если сегодня Валентин сможет вывести PDB-файл молекулы ДНК, то сегодня же можно и попробовать совместить модель ДНК с моделями белков
              [18.12.2016 22:23:53] Andrei: щас тогда напишу ей интересно ли ей это направление
              [18.12.2016 22:24:46] Andrei: или лучше подождать?
              [18.12.2016 22:24:53] Andrei: а то вдруг не сойдется
              [18.12.2016 22:24:56] Кушелев Александр Юрьевич: Вы можете написать, что нам интересно построить полную модель комплекса, т.е. proteins + DNA
              [18.12.2016 22:25:24] Кушелев Александр Юрьевич: Лучше немного подождать. Нужно проанализировать то, что она написала.
              [18.12.2016 22:25:28] Andrei: ага


              Skype, 2016-12-19:

              [2:47:17] Кушелев Александр Юрьевич: PDB-файл ДНК готов: http://nanoworld.org.ru/topic/1530/page/9/
              [8:52:08] Andrei: нужно к нему описание
              [8:52:35] Andrei: что сделано и что хотим показать этим
              [9:13:14] Кушелев Александр Юрьевич: Нужно сделать модель всего комплекса. Вот тогда будет что показать на Нобелевскую smile


              https://img-fotki.yandex.ru/get/110545/158289418.3a5/0_16d5f2_261f4f43_XL.png
              Кушелев: Я так понял, что это сопоставление моей модели TFIIB с моделью из PDB

              https://img-fotki.yandex.ru/get/194425/158289418.3a4/0_16b9a6_dd58245_XL.png
              Модель комплекса из PDB


               ПИКОСОФТ СТАТЬИ, ПЕРЕПИСКА С CASP


              [15:39:17] Кушелев Александр Юрьевич: Несколько кадров из анимации комплекса TBP1+DNA (электронный слой): http://nanoworld.org.ru/post/80544/#p80544

              https://img-fotki.yandex.ru/get/40987/158289418.3a6/0_16d6d0_30af59fd_XL.pnghttps://img-fotki.yandex.ru/get/195990/158289418.3a6/0_16d6d1_ceac4eda_XL.pnghttps://img-fotki.yandex.ru/get/166616/158289418.3a6/0_16d6d2_b69904ab_XL.png

              https://img-fotki.yandex.ru/get/30536/158289418.3a6/0_16d6d4_bf1a6764_XL.pnghttps://img-fotki.yandex.ru/get/30536/158289418.3a6/0_16d6d5_fe0d18a7_XL.pnghttps://img-fotki.yandex.ru/get/40987/158289418.3a6/0_16d6d6_44df52a6_XL.png

              [15:44:34] Кушелев Александр Юрьевич: Тут ещё есть любопытный момент. В банке PDB в комплексе 1VOL показана общепризнанная, но неправильная модель ДНК. Там показаны 16 ступеней ДНК. В пикотехнологической модели комплекса TBP1+DNA (электронный слой) видно, что в белок входит фактически 2 (максимум 3) ступени ДНК. Таким образом можно констатировать факт, что по данным РСА размер ДНК определён с погрешностью типа 400%. Абсолютная ошибка превышает 10 ангстрем в длину участка ДНК.



              Victoriy

              Ещё один момент: АЮ не торопитесь с обнародыванием своей модели ДНК, Вы точно отпугнёте заказчицу. Если с белками как говориться бабушка на двое сказала: у каждого своя конформация, которая ещё может и видоизменяться в процессе функционирования. То в структуре ДНК не сомневается ни один биолог и Вам на слово никто не поверит. Кстати с Вашей "новой" моделью ДНК я тоже не могу согласиться.
              Не надо загружать заказчика Вашими подробностями и трудностями. Сейчас модели белков, нуклеиновых кислот, лигандов вручную никто не совмещает (это дилетантство), обычно используют метод виртуального молекулярного докинга. (дружеский совет во благо)


              Victoriy

              Вопрос к А.Ю.: Ваш файл pdb для нуклеотидной последовательности соответствует общепринятой последовательности атомов в нуклеотиде? Если да, то я буду тоже ориентироваться на данную нумерацию и последовательность атомов, если Вы не сверяли, то это придётся уточнять для однозначного воспроизведения координатных файлов нуклеиновых кислот вьюерами.


              Victoriy пишет:

              Вопрос к Андрею: Вы порекомендовали заказчице покрутить мои модели в Молекулярной Динамике? Мне кажется, что после такой процедуры сходство с моделями, построенными по данным РСА, должно стать ещё больше.

              Предложение для А.Ю. и Андрея: посмотрите в архиве Наномира мои публикации по пикотехнологии (там и про углы, и про карты Рамачандрана, и что самое главное на языке биологии).

              Кушелев: Самое лучшее - это книга "Пикотехнология белков". Андрей хочет прочитать эту книгу.


              Формы, механизмы, энергия наномира. Сообщение 83 096

              Victoriy пишет:

              Сейчас модели белков, нуклеиновых кислот, лигандов вручную никто не совмещает (это дилетантство), обычно используют метод виртуального молекулярного докинга. (дружеский совет во благо)

              Кушелев: Отлично! Значит достаточно передать заказчику PDB-файлы белков и ДНК, и метод молекулярного докинга сделает своё дело.

              Что касается

              Victoriy пишет: Вашей "новой" моделью ДНК я тоже не могу согласиться.

              то эта модель ДНК была создана в 2011 году. Сегодня я планирую создать окончательный PDB-файл двухцепочечной пикотехнологической модели РНК / ДНК (ядерный слой), который можно будет отослать заказчику для совмещения с моделями белков комплекса 1VOL.

              Как видите, в среде 3DS Max модель ДНК идеально совместилась с моделью белка TBP1. Кстати, Вы тоже можете попробовать совместить Ваши модели белков и ДНК. Вдруг они у Вас тоже идеально совместятся smile

              https://img-fotki.yandex.ru/get/194425/158289418.3a6/0_16d75b_ac62a198_XL.png
              Анимировать: https://cloud.mail.ru/public/Ft3F/o4v8jS5ov

              Совмещение пикотехнологической модели ДНК (ядерный слой) с пикотехнологической моделью белка TBP1. Отчётливо видно сопряжение на уровне трёх ступеней ДНК.

              https://img-fotki.yandex.ru/get/30536/158289418.3a6/0_16d6d4_bf1a6764_XL.png
              Анимировать: https://cloud.mail.ru/public/Ft3F/o4v8jS5ov

              Совмещение пикотехнологической модели ДНК (электронный слой) с пикотехнологической моделью белка TBP1


              Victoriy пишет:

              Вопрос к А.Ю.: Ваш файл pdb для нуклеотидной последовательности соответствует общепринятой последовательности атомов в нуклеотиде? Если да, то я буду тоже ориентироваться на данную нумерацию и последовательность атомов, если Вы не сверяли, то это придётся уточнять для однозначного воспроизведения координатных файлов нуклеиновых кислот вьюерами.

              Кушелев: Я взял из базы PDB-файл с ДНК и просто поменял координаты.


              Формы, механизмы, энергия наномира. Сообщение 83 100

              Skype, 2016-12-19:

              [16:18:31] Andrei: так подождем до второй модели?
              [16:26:39] Кушелев Александр Юрьевич: Вообще-то и первая модель белка - гарантия успеха
              [16:27:36] Кушелев Александр Юрьевич: Так что можно посылать 4 ролика анимации, а PDB-модель нужно смасштабировать на коэффициент 0.6 Лучше это сделать самим.
              [16:27:53] Кушелев Александр Юрьевич: Жаль, что программист занят. Он бы это сделал за 5 минут
              [16:28:05] Andrei: не проблема, подождем
              [16:28:57] Кушелев Александр Юрьевич: Через час-два попробую разобраться со вторым белком
              [16:29:19] Кушелев Александр Юрьевич: Он не такой очевидный, а в базе данных PDB вообще "полный привет" smile
              [16:30:04] Кушелев Александр Юрьевич: Там альфа-спирали нарисовали "как бог на душу положит", а модель ДНК с неправильной ориентацией ступеней, поэтому короче в 4 раза smile
              [16:30:21] Andrei: https://cloud.mail.ru/public/5j2J/R81Y4QJjC
              [16:30:29] Andrei: это не работает
              [16:30:41] Andrei: и вторая тоже
              [16:30:48] Кушелев Александр Юрьевич: Я заменил 2 ролика на 4
              [16:30:51] Andrei: аа
              [16:31:06] Кушелев Александр Юрьевич: Названия поменялись, поэтому я старые два стёр
              [16:31:19] Andrei: надо было тут тоже стереть
              [16:31:26] Кушелев Александр Юрьевич: ОК
              [16:31:33] Кушелев Александр Юрьевич: Исправлюсь в будущем
              [16:31:45] Кушелев Александр Юрьевич: Появлюсь через час-два
              [16:34:46] Andrei: может там надо подписать в видео что там что?
              [17:59:16] Кушелев Александр Юрьевич: Там в названии подписано
              [17:59:36] Andrei: ну пусть так
              [18:00:05] Кушелев Александр Юрьевич:
              [16:28:20] Кушелев Александр Юрьевич: Привет! А ты можешь все координаты в PDB-файле умножить на 0.6 ?
              [17:43:34] Va12220(valqwa): МОГУ )
              сегодня как доеду и вспомню - то сделаю
              [18:00:37] Andrei: отлично
              [19:00:33] Кушелев Александр Юрьевич: Комплекс TBP1+DNA идеально вложился в полость белка TFIIB smile
              Сейчас компьютер делает анимацию.
              [19:00:42] Andrei: супер
              [19:01:55] Кушелев Александр Юрьевич: Виктория написала на форуме, что против моей модели ДНК. Интересно будет посмотреть, как вставится в комплекс модель ДНК от Виктории. Она пыталась сделать свою модель ДНК максимально приближенной к общепринятой, т.е. из банка PDB
              [19:27:43] Кушелев Александр Юрьевич: Это ещё один ролик с TBP1, но без электронного слоя. Так больше видно. https://cloud.mail.ru/public/BR8K/MoUHKhtG5
              [19:28:10] Кушелев Александр Юрьевич:

              А это ролик всего комплекса 1VOL:

              https://cloud.mail.ru/public/5eaU/5T7v7mCwM

              https://img-fotki.yandex.ru/get/49312/158289418.3a6/0_16d828_a1b23880_XL.png
              [19:29:15] Кушелев Александр Юрьевич: Короче, ДНК вставляется в маленький белок TBP1, а он в свою очередь вставляется в полость более крупного белка TFIIB
              [19:31:07] Кушелев Александр Юрьевич: Конечно, нужно ещё применить инструмент "молекулярная динамика", чтобы из жесткой геометрической модели получить гибкую физическую, но это уже профессионалы разберутся smile
              [19:36:57] Кушелев Александр Юрьевич: Кстати, Виктория написала на форуме, что совмещение белков автоматизировано. Так что наш заказчик может самостоятельно совместить PDB-файл модели DNA/RNA с моделью белка TBP1, а потом совместить этот комплекс с белком TFIIB. Технологию молекулярной динамики нужно будет применить сначала после, а потом до совмещения. Если молекулярная динамика на уровне нанотехнологии портит пикотехнологические модели, то применение до совмещения даст хуже результат совмещения.
              Кстати, комплекс 1VOL похож на 3 матрёшки. Самая маленькая - ДНК, вторая - белок TBP1, а самая большая - белок TBIIB
              [19:37:43] Andrei: так ее модель тоже подошла?
              [19:38:59] Кушелев Александр Юрьевич: Виктории? Это мы скоро узнаем smile
              [19:39:03] Andrei: молекулярная динамика это известное что-то всем?
              [19:39:10] Кушелев Александр Юрьевич: Да
              [19:39:21] Кушелев Александр Юрьевич: Программа PyMol её может делать
              [19:39:49] Кушелев Александр Юрьевич: У Виктории и у заказчика она есть, а у меня была, но сейчас нет
              [19:40:19] Кушелев Александр Юрьевич: Для неё желательно отдельный компьютер иметь, иначе может всё посыпаться...



              Andrei01 пишет:Victoriy пишет:

              Вопрос к Андрею: Вы порекомендовали заказчице покрутить мои модели в Молекулярной Динамике? Мне кажется, что после такой процедуры сходство с моделями, построенными по данным РСА, должно стать ещё больше.

              Виктория, а вы можете примеры привести, что сходство увеличится? То есть разница в 18А там уменьшится?

              Victoriy

              Андрей, я уже Вам писала, что в отличие от Кушелева, моя программа моделирует не конечную конформацию белка, а его СТРУКТУРНЫЙ ШАБЛОН (хотя он оказался ближе к экспериментальным моделям, чем у А.Ю.). Т.е. это структура белка, которая синтезируется на рибосоме БЕЗ влияния микроокружения, но по собственному генкоду (точнее гену). В клетке после того, как структурный шаблон белка синтезирован он подвергается действию всевозможных физических сил (начиная от электростатических и заканчивая Ван-дер-вальсовыми). Этот процесс носит название фолдинг белка. Так вот, процесс фолдинга моего структурного шаблона в конечную конформацию белка можно смоделировать при помощи молекулярной динамики. Мы получим функциональную конформацию белка, которая будет сравнима с моделями, построенными по данным РСА. И разумеется разница в 16,5 Ангстрем должна в разы уменьшиться. А сейчас заказчик сравнивает жесткий скелет с гибким телом и естественно получает такие расхождения. Вот я и предлагаю заказчику самостоятельно превратить скелет в гибкое тело, удивиться и поверить в свой собственный результат, тем более, что нужен он ей, а не мне.

              Victoriy А.Ю., обратите внимание, что Вы сделали модель комплекса с 3-мя нуклеотидами, вместо 16. И если в узле состыковки нуклеотидные хвосты не актуальны, то комплементарные пары нуклеотидов должны быть. Я так думаю:)

              Andrei01

              Виктория, хорошо. Напишу им об этом. Поэтому они и слали свои данные, чтобы мы поняли почему такое различие большое в 6 раз.

              Формы, механизмы, энергия наномира. Сообщение 83 107

              Victoriy пишет:

              в отличие от Кушелева, моя программа моделирует не конечную конформацию белка, а его СТРУКТУРНЫЙ ШАБЛОН (хотя он оказался ближе к экспериментальным моделям, чем у А.Ю.)

              Кушелев

              Уважаемая Виктория! А Вы не могли бы осуществить автоматических докинг моделей белков TBP1 и TFIIB ?

              Интересно посмотреть, состыкуются ли Ваши модели между собой и мои модели между собой автоматически?

              Вручную у меня получилось: https://cloud.mail.ru/public/5eaU/5T7v7mCwM

              https://img-fotki.yandex.ru/get/49312/158289418.3a6/0_16d828_a1b23880_XL.png

              Теперь интересно проверить автоматизированный докинг. Насколько он работоспособен? smile

              Кстати, непонятно, как Ваша программа строит 310-спирали? По Вашей таблице их в шаблоне быть не должно...

              Victoriy пишет:

              А.Ю., обратите внимание, что Вы сделали модель комплекса с 3-мя нуклеотидами, вместо 16. И если в узле состыковки нуклеотидные хвосты не актуальны, то комплементарные пары нуклеотидов должны быть. Я так думаю:)

              Кушелев: Я специально убрал половину нуклеотидов, чтобы виднее было. А на модели, где показаны только ядра, ступени целые (пары нуклеотидов). В файле PDB тоже модель двойной ДНК, причём все 16 ступеней.

              А заказчик может укорачивать и разбирать модель ДНК из PDB-файла по своему усмотрению.

              Формы, механизмы, энергия наномира. Сообщение 83 109

              Andrei01 пишет:

              Виктория, хорошо. Напишу им об этом. Поэтому они и слали свои данные, чтобы мы поняли почему такое различие большое в 6 раз.

              Кушелев: Самое интересное - провести автоматический докинг для комплекса 1VOL. Он должен дать разный результат для вариантов моделей Виктории Соколик и Александра Кушелева. Интересно же посмотреть, в каком варианте лучше состыкуются белки между собой и с ДНК smile


              Victoriy

              Увы, у меня пока нет навыков самостоятельного выполнения докинга, тем более 3 высокомолекулярных полимеров. С коллегами из Киева в этом году был сделан докинг куска из 63 а.о. белка предшественника амилоида (AбетаPP), содержащего сам бета-амилоидный пептид, с куркумином. Опубликовано в Advances in Biochemistry. – 2016. – V. 4, Is. 4. – P. 34-46.
              Поэтому я и призываю в нашу команду биоинженера/молекулярного биолога с опытом работы в молекулярном моделировании.


              Кушелев: А может быть программы типа PyMol могут автоматически выполнять докинг двух белковых молекул?


              Victoriy

              Мы использовали инструмент CCDC GOLD Suite 5.1 для докинга и его же оценочные функции для характеристики устойчивости комплекса. Для меня PyMol не более чем вьюер.


              Татьяна Рясина

              На сегодняшний день мы стали проще относиться к идолу РСА в результате продолжительной беседы.

              Почему бы не выработать отношение попроще и к идолу ДНК?

              Вот допустим ответы по задачке заказчицы готовы, пусть они даже отправлены.

              Можно же написать что-то вроде, вдогонку:
              Позвольте ознакомить Вас с нашей критикой общепринятой модели ДНК
              Мы провели моделирование ДНК методами Пикотехнологии.
              Наши поправки по алгоритмам Пикотехнологии выявили следующие различия с общепринятой моделью /....../
              Корректность наших поправок подтверждается тем что /...../
              В дополнении к только что решённой нами для Вас задаче и при совмещении полученной структуры и нашей модели ДНК мы получим следующее /......./ Таким образом /......./

              И ещё вопрос к уважаемым изобретателям Пикотеха:
              кто напишет в Германию в лабораторию которая увидела электроны-колечки на АСМ
              про то что:
              1) мы занимаемся моделированием атомов, молекул и молекулярных структур с помощью модельного представления об электронов как о закольцованных стоячих волнах (ссылки)
              2) Ваша работа подтверждает эти модели
              3) Мы разработали Пикотех для моделирования белковых структур
              3) Проверьте пожалуйста базовые структуры белков экспериментально (список наименований, дизайн эксперимента)

              Андрей и Виктория, вы можете сформировать максимально полый список критики,  вопросов, опровержений и пр. по модели ДНК А.Ю., чтобы в итоге получить хорошую аргументацию в её пользу...


              Кушелев

              Всё это актуально, но сложно на уровне голого энтузиазма. Нужно найти заинтересованных людей, которые продвинут новое научное направление "по полной программе". Ведь пикотехнология белков была создана уже в 1993-ем году, а развивается она без нормального финансирования "черепашьими шагами"...



              Victoriy пишет:

              А.Ю., мне интересно: в Вашей модели комплекса последовательность нуклеотидов не имеет значение?

              Кушелев: Нет, конечно. Если комплекс занимается транскрипцией ДНК, то он должен одинаково хорошо заниматься транскрипцией любых последовательностей.

              Кстати, ключевые аминокислотные остатки как бы прикасаются к центральным зонам соседних ступеней ДНК:

              https://img-fotki.yandex.ru/get/197102/158289418.3a6/0_16d875_2ffb2fe9_XL.png


              Skype:

              [19.12.2016 19:44:15] Andrei: Щас попробую все оформить и послать им
              [19.12.2016 19:47:32] Кушелев Александр Юрьевич: Скоро приедет домой программист. Тогда будет нормальный PDB-файл DNA / RNA
              [19.12.2016 19:56:12] Andrei: а, я думал уже готово
              [19.12.2016 19:56:42] Andrei: А это ролик всего комплекса 1VOL:
              [19.12.2016 20:00:15] Кушелев Александр Юрьевич: Ролик-то готов, а PDB-файл ДНК/РНК ещё не готов
              [19.12.2016 20:01:58] Andrei: Книга вроде 74 евро стоит
              [19.12.2016 20:02:20] Кушелев Александр Юрьевич: Да. Электронный вариант 6 USD
              [19.12.2016 20:02:31] Andrei: там не было электронного варианта
              [19.12.2016 20:02:48] Кушелев Александр Юрьевич: У авторов есть
              [19.12.2016 20:04:45] Andrei: как называется ядерный слой на английском?
              [19.12.2016 20:05:23] Кушелев Александр Юрьевич: nuclear
              [19.12.2016 20:05:56] Andrei: nuclear layer?
              [19.12.2016 20:06:15] Кушелев Александр Юрьевич: Да. В файлах подписано nuclear и electronic
              [19.12.2016 20:06:34] Andrei: ок
              [19.12.2016 20:06:59] Andrei: Файлы лучше загружать на dropbox
              [19.12.2016 20:07:36] Andrei: а то сайт на русском, они не поймут
              [19.12.2016 20:08:29] Кушелев Александр Юрьевич: Загрузите, если сможете smile
              [19.12.2016 20:08:42] Andrei: загружаю
              [19.12.2016 20:08:44] Кушелев Александр Юрьевич: Или в письмо вложите
              [19.12.2016 20:09:05] Andrei: в письмо не получится, тот сайт на русском
              [19.12.2016 20:09:29] Кушелев Александр Юрьевич: Вы тогда ссылочку на эти файлы в dropbox опубликуйте, чтобы англоязычные читатели форума тоже смогли скачать и изучить.
              [19.12.2016 20:09:46] Кушелев Александр Юрьевич: Сами файлы в письмо можно вложить по любому
              [19.12.2016 20:10:04] Andrei: нет конечно, почта не пропустит
              [19.12.2016 20:10:34] Andrei: я не даю ссылки для всех
              [19.12.2016 20:11:13] Кушелев Александр Юрьевич: Только русскоязычным разрешаете файлы скачивать? wink
              [19.12.2016 20:11:33] Andrei: там настройки есть
              [19.12.2016 20:11:40] Кушелев Александр Юрьевич: Ушлые китайцы всё-равно с облака мэйл ру скачают smile
              [19.12.2016 20:11:40] Andrei: надо настраивать специально
              [19.12.2016 20:45:19] Andrei: так у вас тоже не учитываются силы на белок как у Виктории?
              [19.12.2016 20:49:08] Кушелев Александр Юрьевич: Мой алгоритм пока реализован на геометрическом уровне, но генетический код дублирует физико-химические взаимодействия, поэтому подавляющее большинство участков белковых молекул не модифицируются после рибосомальной сборки белка. А те, которые модифицируются, можно смоделировать по дополнительной информации. Бывают и редкие случае, когда "всё сложно"
              [19.12.2016 20:50:41] Кушелев Александр Юрьевич: В нашем случае 1VOL похоже, что белки не модифицируются, но в нормальных условиях они могут гнуться, защёлкиваться и т.д. Так что по хорошему учитывать физику и химию нужно.
              [19.12.2016 20:50:57] Кушелев Александр Юрьевич: Это уже проблема заказчика.
              [19.12.2016 20:51:30] Кушелев Александр Юрьевич: Если нам закажут исследование динамики белка, тогда это будет уже "совсем другая песня" и "совсем другие деньги"
              [19.12.2016 20:51:58] Andrei: а почему же тогда оно налезло друг на друга само?
              [19.12.2016 20:52:52] Кушелев Александр Юрьевич: Исследователи белков могут выращивать кристаллы в разных условиях, добиваясь фиксации молекул в разных состояниях. В результате они могут получить "фотки" в разных положениях частей молекулы белка.
              [19.12.2016 20:53:38] Кушелев Александр Юрьевич: В нашем случае ДНК и белки совместились, т.к. их форма сильно не меняется после сборки рибосомой
              [19.12.2016 20:54:09] Кушелев Александр Юрьевич: А бывают белки, которые надкусываются, из кусков собираются крупные агрегаты и т.д.
              [19.12.2016 22:50:42] Кушелев Александр Юрьевич: Программист ещё едет домой smile
              [19.12.2016 22:50:59] Кушелев Александр Юрьевич: А Вы аннотацию к книге "Пикотехнология белков" заказчику посылали?
              [19.12.2016 22:51:01] Кушелев Александр Юрьевич:
              The greatest enemy of knowledge is not ignorance, it is the illusion
              Stephen Hawking
              Sokolik VV, Kushelev AY
              Geometry live nanoworld. Pikotechnology proteins / VV Sokolik, AY Kushelev. -
              Kharkov: Publishing, 2015. – 255 p.

              ISBN 978-3-659-92862-8

              The monograph is devoted to the 3D-structure of molecules and polymers in
              living systems. The analysis of the modern understanding of the fundamental concepts
              of the physical volume of the atom, chemical bonding, and the genetic code is
              presented. Based on statistical analysis of the experimental data on the protein structure
              is justified coding secondary structure and structural polypeptide template of protein
              in the genome. Propose additions table of the genetic code of proteins and peptides,
              which formed the basis of the geometric algorithm software decoding structural
              template protein, are Molecular Constructor and Picotex. The hypothesis of recoding
              information to third nucleotide codon in the corresponding peptide bond rotamer directly
              3D-structure isoacceptors tRNA is formulated. Mathematical analysis of contingency
              angles φ and ψ (Ramachandran map) revealed their frequency changes as
              possible to substantiate the mechanism of post-translational protein folding.
              The book is intended for professionals involved in research in the field of molecular
              biology, bioinformatics, biochemistry and biophysics.
              Table: 36. Ill: 117. Refs: 227 titles.
              [19.12.2016 22:51:40] Andrei: Ну как доедет, не горит)
              [19.12.2016 22:51:52] Andrei: Посылал
              [19.12.2016 22:52:12] Кушелев Александр Юрьевич: А рецензии?
              [19.12.2016 22:52:14] Кушелев Александр Юрьевич: http://nanoworld.org.ru/topic/1150/
              [19.12.2016 22:52:26] Кушелев Александр Юрьевич: Это самое научное...
              [19.12.2016 22:56:29] Andrei: тоже, это все теория
              [19.12.2016 22:56:34] Andrei: нужны примеры
              [19.12.2016 22:57:52] Кушелев Александр Юрьевич: Какая же теория, когда речь идёт о модельных экспериментах, подтверждённых в 2015-ом году натурными (АСМ)?
              [19.12.2016 22:58:15] Andrei: на практике нет применений
              [19.12.2016 22:59:20] Кушелев Александр Юрьевич: Пикотехнология белков - это и есть практическая технология, которая базируется на модельных экспериментах теперь уже подтверждённых прямыми экспериментами (АСМ)
              [19.12.2016 23:00:00] Andrei: коммерческой прибыли нет от этого на практике
              [19.12.2016 23:00:05] Andrei: надо искать
              [19.12.2016 23:01:25] Кушелев Александр Юрьевич: Виктория пишет, что не владеет программой, где делается автоматический докинг. Может быть имеет смысл попросить заказчика применить автоматический докинг для сравнения моделей белков и ДНК от Кушелева и Соколик?
              А раз заказчик может сравнивать модель Кушелева с моделью из PDB, значит сможет сравнить и модель Кушелева с моделью Соколик. Интересно, на сколько ангстрем отличаются наши модели?
              [19.12.2016 23:01:36] Кушелев Александр Юрьевич: Прибыль будет, не торопитесь.
              [19.12.2016 23:01:52] Andrei: ничего просить не можем
              [19.12.2016 23:02:22] Кушелев Александр Юрьевич: А предлагать?
              [19.12.2016 23:02:31] Andrei: покажем идеи а дальше если стоящая то может быть сможет найти практическое применение
              [19.12.2016 23:03:24] Кушелев Александр Юрьевич: Они же сами заинтересованы сделать модель комплекса 1VOL. Если они умеют делать автоматический докинг, то смогут попытаться сделать его в варианте моделей Кушелева и Соколик. В одном из вариантов должно получиться лучше.
              [19.12.2016 23:03:38] Кушелев Александр Юрьевич: У меня вручную получилось, а у них автоматически должно получиться.
              [19.12.2016 23:04:04] Andrei: зачем им это
              [19.12.2016 23:06:16] Кушелев Александр Юрьевич: Их цель, как я понял, выяснить механизм работы комплекса 1VOL
              [19.12.2016 23:06:30] Кушелев Александр Юрьевич: Применить для этого автоматический докинг - сам бог велел smile
              [19.12.2016 23:07:15] Кушелев Александр Юрьевич: А дальше они могут сравнить, какие модели лучше собираются в "матрёшки", от Кушелева или от Виктории. Они же рассчитали 18 и 16.5 ангстрем?
              [19.12.2016 23:07:20] Кушелев Александр Юрьевич: Значит нужно.
              [19.12.2016 23:07:30] Andrei: что дает докинг?
              [19.12.2016 23:08:04] Кушелев Александр Юрьевич: Автоматическую сборку "матрёшки". Я-то делал вручную. Интересно получится та же структура в автоматическом режиме?
              [19.12.2016 23:08:36] Andrei: пусть сначала это посмотрят
              [19.12.2016 23:08:46] Andrei: посмотрим что скажут
              [19.12.2016 23:08:47] Кушелев Александр Юрьевич: Безусловно



              Skype, 2016-12-20:

              [0:33:35] Кушелев Александр Юрьевич: Программист добрался до дома. Сказал, что сейчас сделает PDB-файл ДНК
              [0:52:15] Кушелев Александр Юрьевич: Файл готов: http://nanoworld.org.ru/post/80584/#p80584

              https://img-fotki.yandex.ru/get/196161/158289418.3a6/0_16d877_bbba6c36_XL.png

              https://img-fotki.yandex.ru/get/195125/158289418.3a6/0_16d878_6d535a5d_XL.png

              PDB-файл: https://cloud.mail.ru/public/LNUH/7JNWA75Nk



              ОБНАРУЖЕНА ОШИБКА В ПРОГРАММЕ, ИСПРАВЛЯЕМ   1 ,  2


              aest пишет:

              вы пытались продавать наивным биологам ваши модели белков по 10000 уе, заверяя о пикоточности в то время, как у вас в алгоритме ошибка была ? Некрасиво как-то получается.

              Кушелев: Конечно некрасиво. Поэтому пытаемся исправить ошибку, но это дело непростое... Углы уже удалось исправить, но в программе Дениса Савина где-то ещё запрятаны смещения. Ищем smile